Align prephenate dehydrogenase (EC 1.3.1.12) (characterized)
to candidate WP_066328701.1 BLR17_RS00145 prephenate dehydrogenase
Query= BRENDA::O67636 (311 letters) >NCBI__GCF_900100165.1:WP_066328701.1 Length = 285 Score = 155 bits (393), Expect = 8e-43 Identities = 91/273 (33%), Positives = 147/273 (53%), Gaps = 6/273 (2%) Query: 33 VLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSP 92 V ++G+G +GGS ++ IYG D N + + +A++LG+ID T +ED S Sbjct: 3 VFVIGIGLIGGSMVLDIKALYPGATIYGIDNNEKHLQQALELGVIDVAAT----MEDLSE 58 Query: 93 -DFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKR-FVGGHPIA 150 DFV++S PV + K+ ++ ++A V + GS K + + N +R F+ HPIA Sbjct: 59 ADFVIVSVPVNVAIGLLPKVLDLVGDNAIVFEVGSTKNPICQAIANHPKRRNFIATHPIA 118 Query: 151 GTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYVFG 210 GTE SG +L +L+ GK I+ +KT K + V+ +G + YM P+ HD Sbjct: 119 GTEFSGPSAALRDLFRGKTNIICEVEKTAFKLQEKALEVFNKMGMRIRYMDPKSHDKHIA 178 Query: 211 VVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFTRIAKSDPIMWRDIFLENKENV 270 VSHL H +F L T+I+ E D+F G GF+ R+AKS P MW IF +NK V Sbjct: 179 YVSHLSHISSFMLGKTVINKEKDEQDIFDMAGSGFESTVRLAKSSPAMWTPIFEQNKTQV 238 Query: 271 MKAIEGFEKSLNHLKELIVREAEEELVEYLKEV 303 ++++E + +L ++L+ ++ + E + V Sbjct: 239 LESLEEYISNLTQFRDLLAQDDYNAIYEEMASV 271 Lambda K H 0.318 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 285 Length adjustment: 26 Effective length of query: 285 Effective length of database: 259 Effective search space: 73815 Effective search space used: 73815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory