Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_085218250.1 B9N75_RS07610 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_900177405.1:WP_085218250.1 Length = 389 Score = 216 bits (551), Expect = 7e-61 Identities = 123/382 (32%), Positives = 200/382 (52%), Gaps = 3/382 (0%) Query: 4 AKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHGY 63 A+ LQR +S F + EA KLEAQG +IHL G+P TP H+ +A K ALD G Y Sbjct: 5 AQRLQRSSNKS-FGMYEEAVKLEAQGLDLIHLEFGRPHADTPGHIKEAVKTALDAGIVHY 63 Query: 64 VLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTPA 123 G L RQA+ K+ D + +L+ G + A +PG E+I P Sbjct: 64 GDFRGTLSFRQALAEKLTDFNKLDYGVDEILVTNGLTHASFAAFMAAIDPGDEVILLEPY 123 Query: 124 FPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEKS 183 +P + + + G T V L + I + IT KTR+++L+NP NPTG ++ Sbjct: 124 YPQHVAKVELAGGTVVTAPLDAANNFAISHAAIAAKITPKTRMIVLVNPANPTGRVYTRA 183 Query: 184 AIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAMTG 243 ++++AE H + +L DE+Y YDG E + + P +++R I ++KAY+M G Sbjct: 184 ELEIVAELAIAHDLI-VLCDEVYEYITYDGAEHVSIASLPGMRERTITCFAFTKAYSMDG 242 Query: 244 WRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKLI 303 WR+G+ LIP + ++I V+ VN Q AA+ GP + +H M+ ++R+++ Sbjct: 243 WRVGYLTADARLIPAILRIITTDVTHVNVFVQEGARAAVTGPQEPMHAMVEADRRKREIV 302 Query: 304 HEGLNSLPGVECSLPGGAFYAFPKVIGTGMNGSEFAKKCMHEAGVAIVPGTAFGKTCQDY 363 LN +PGV C+ P G YAFP + GTG + A + +H+A V G+ +G + + Sbjct: 303 VRALNQMPGVTCAEPQGTIYAFPDIRGTGRTSAALATEILHKAHVVTEAGSFYGPAGEGH 362 Query: 364 VRFSYAA-SQDNISNALENIKK 384 +R + + S++ + +E + + Sbjct: 363 LRICFGSESEERVREGMERLTR 384 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 389 Length adjustment: 30 Effective length of query: 357 Effective length of database: 359 Effective search space: 128163 Effective search space used: 128163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory