Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate WP_085217035.1 B9N75_RS00550 imidazole glycerol phosphate synthase subunit HisH
Query= CharProtDB::CH_024511 (196 letters) >NCBI__GCF_900177405.1:WP_085217035.1 Length = 192 Score = 147 bits (372), Expect = 9e-41 Identities = 83/193 (43%), Positives = 111/193 (57%), Gaps = 5/193 (2%) Query: 3 VVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVREREL 62 + I+D GC NL SV++ R G P + DP + AD++ LPGVG A AM ++ L Sbjct: 2 LAIVDLGCGNLGSVRAGFERLGLAPVTTCDPGAIAAADRIVLPGVGAAGYAMARIHALGL 61 Query: 63 FDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDF-GLPLPHMGWNRV 121 ++I+ QP+LGICLGMQLL RSEE G LGI+ V + GLP+PHMGWN + Sbjct: 62 AEVIQQLRQPLLGICLGMQLLFERSEE-GGTACLGILPGTVRALKSARGLPVPHMGWNSL 120 Query: 122 YPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPER 181 A G++ G + YF HS+A + T A+ YG A V +N +G QFHPER Sbjct: 121 ---ARAESGFGLDAGDHLYFAHSFACDASAATTAEVVYGRTIAALVASNNVWGAQFHPER 177 Query: 182 SGAAGAKLLKNFL 194 S GA+ LK +L Sbjct: 178 SAEPGARFLKAWL 190 Lambda K H 0.322 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 192 Length adjustment: 20 Effective length of query: 176 Effective length of database: 172 Effective search space: 30272 Effective search space used: 30272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
Align candidate WP_085217035.1 B9N75_RS00550 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.1985020.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-58 181.4 0.0 1e-57 181.2 0.0 1.0 1 NCBI__GCF_900177405.1:WP_085217035.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900177405.1:WP_085217035.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.2 0.0 1e-57 1e-57 2 196 .. 3 190 .. 2 192 .] 0.93 Alignments for each domain: == domain 1 score: 181.2 bits; conditional E-value: 1e-57 TIGR01855 2 vvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvvkkkkpv 74 +++d g+gNl sv+ +er+g ++ ++d ++ ad++vlPGVGa+ am++++ l+ lae +++ ++p+ NCBI__GCF_900177405.1:WP_085217035.1 3 AIVDLGCGNLGSVRAGFERLGLAPVTTCDPGAIAAADRIVLPGVGAAGYAMARIHALG---LAEVIQQLRQPL 72 79********************************************************...4455789999** PP TIGR01855 75 lgiClGmQllfekseEgkevkglglikgkvkkleaek..kvPhiGWnevevvkesellkgleeearvYfvHsY 145 lgiClGmQllfe+seEg+ + +lg+++g+v+ l+++ +vPh+GWn++ +++ gl++++++Yf Hs+ NCBI__GCF_900177405.1:WP_085217035.1 73 LGICLGMQLLFERSEEGG-TACLGILPGTVRALKSARglPVPHMGWNSLARAESG---FGLDAGDHLYFAHSF 141 ****************75.79*************99999********77665554...689************ PP TIGR01855 146 aveleeeeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllknfl 196 a + a++a + yg+++ a+v+++n+ g+QFHPE+S++ G+++lk +l NCBI__GCF_900177405.1:WP_085217035.1 142 ACDASA--ATTAEVVYGRTIAALVASNNVWGAQFHPERSAEPGARFLKAWL 190 *99987..99**************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (192 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.37 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory