Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate WP_085217718.1 B9N75_RS04530 LL-diaminopimelate aminotransferase
Query= metacyc::MONOMER-6501 (397 letters) >NCBI__GCF_900177405.1:WP_085217718.1 Length = 393 Score = 141 bits (356), Expect = 3e-38 Identities = 114/400 (28%), Positives = 187/400 (46%), Gaps = 29/400 (7%) Query: 4 RLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIA--ANLAGLSV 61 R+ + PY F ++ A+ A A D+ ++L +G P A PA V + +A A Sbjct: 7 RIRRMPPYVFAEVNAMKAAARARGEDI--VDLGMGNPDGAPPAHVVEKLAEVARDPRAHR 64 Query: 62 YPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGALVV 121 Y ++KG LR+A + + RR+ + A DP+SEV+ LGS+E L AQ + P G +V+ Sbjct: 65 YSASKGIAGLRRAQAAYYQRRFDV-ALDPDSEVIVTLGSKEGLANLAQAITAP--GDVVL 121 Query: 122 CPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPAGN 181 PNP Y I++ ++AGA + A P DF R + ++ + P NP Sbjct: 122 APNPSYPIHQFGFIIAGAAIRSIPAAPGPDFFTRLEFAIRYTVPKPTVLVIGYPSNPTAY 181 Query: 182 VMSLEEWRTLFELSDRHGFVIAAYECYSEIYL-DEDTPPLGSLQAARRLGRDRYTNLVAF 240 V L+ +R + + + H + + Y+EIY D TP + + A+ + V F Sbjct: 182 VADLDFYRKVVDFAREHKLWVISDLAYAEIYFGDTPTPSILEVLGAKEVA-------VEF 234 Query: 241 SSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRR--MCRK 298 +S+SK ++ G R GF G+ L+A ++Y V AA++AA + + + Sbjct: 235 TSMSKTYSMAGWRIGFAVGNPTLIAALARVKSYLDYGAFTPVQAAAVAALNGPQDIVAHN 294 Query: 299 TAQYRAKFEAVLPILQNV-LDVRAPQASFYLWAGTPG-----SDTAFARELYGRTGVTVL 352 A Y+ + + ++ +++ P+AS + W P FA+ L GV V Sbjct: 295 RALYKGRRDCLIESFGRAGWEIQKPEASMFAWTPIPEPFRHLGSMEFAKRLLAEAGVAVA 354 Query: 353 PGSLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHF 392 PG E G+G +RIALV + QAA + F Sbjct: 355 PGVGFGEE------GEGFVRIALVENEHRLRQAARAVKKF 388 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 393 Length adjustment: 31 Effective length of query: 366 Effective length of database: 362 Effective search space: 132492 Effective search space used: 132492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory