Align Anthranilate synthase beta subunit 1, chloroplastic; OsASB1; Anthranilate synthase, glutamine amidotransferase component 2-1; EC 4.1.3.27 (characterized)
to candidate WP_085217592.1 B9N75_RS03755 glutamine-hydrolyzing GMP synthase
Query= SwissProt::Q7XUS2 (288 letters) >NCBI__GCF_900177405.1:WP_085217592.1 Length = 520 Score = 70.9 bits (172), Expect = 6e-17 Identities = 60/201 (29%), Positives = 92/201 (45%), Gaps = 21/201 (10%) Query: 84 IIVIDNYDSFTYNLCQYMGELGLNFEV--YRNDELTIEDVKRKNPRGILISPGPGEPQDS 141 I+++D T + + + E G+ E+ + + + +K PRGI++S GP Sbjct: 9 ILIVDFGSQVTQLIARRVREAGVYSEIAPFNAADAAFDRLK---PRGIILSGGPASVTAE 65 Query: 142 GI--SLQTVLELGPTIPIFGVCMGLQCIGEAFGGKIIRAPSGVMHGKSSPVRYDEELGKA 199 G + Q E G IPI G+C G Q + E GGK++ G G+ D E A Sbjct: 66 GSPRAPQRFFEAG--IPILGICYGQQVMCEQLGGKVV---GGQGEGEFGRAFIDIEGQSA 120 Query: 200 LFNGLPNPFTAARYHSLVIEQ----ETFPHDALEATAWTEDGLIMAARHKKYRHIQGVQF 255 LF+GL + A H + + T P A +G A + R G+QF Sbjct: 121 LFDGL---WGAGGRHQVWMSHGDKVATLPEGF--APVAVSEGAPYAVTSDEARRFFGIQF 175 Query: 256 HPESIITPEGKRIILNFVRFI 276 HPE + TP+G ++I NFVR + Sbjct: 176 HPEVVHTPDGGKLIANFVRHV 196 Lambda K H 0.318 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 520 Length adjustment: 30 Effective length of query: 258 Effective length of database: 490 Effective search space: 126420 Effective search space used: 126420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory