GapMind for Amino acid biosynthesis

 

Alignments for a candidate for trpD_1 in Sphingomonas indica Dd16

Align anthranilate synthase (subunit 1/2) (EC 4.1.3.27) (characterized)
to candidate WP_085217719.1 B9N75_RS04535 GMP synthase

Query= BRENDA::P09786
         (200 letters)



>NCBI__GCF_900177405.1:WP_085217719.1
          Length = 230

 Score = 47.8 bits (112), Expect = 2e-10
 Identities = 36/107 (33%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 68  ELLAWARGRLPVLGVCLGHQALALAAGGAVGEARKPLHGKSTSL-RFDQ--RHPLFDGIA 124
           + L  ARG   ++G+C GHQ +A A GG V ++ K   G    L R+D     P  DG A
Sbjct: 77  QFLRDARGVAKLVGICFGHQIMAEAFGGRVEKSDK---GWGVGLHRYDMLAERPWMDGTA 133

Query: 125 DLRVARYHSLVVSRLPEGFDCLADADGEIMAMADPRNRQLGLQFHPE 171
            + +A  H   V   P   + LA  +    AM    +  L +Q HPE
Sbjct: 134 PIAIAVSHQDQVVAPPPDAEVLASCEFTPYAMLGWGDEALSMQCHPE 180


Lambda     K      H
   0.325    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 107
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 200
Length of database: 230
Length adjustment: 22
Effective length of query: 178
Effective length of database: 208
Effective search space:    37024
Effective search space used:    37024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory