Align D-lactate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate WP_041753416.1 PCRYO_RS04640 FAD-binding oxidoreductase
Query= reanno::Smeli:SMc00833 (405 letters) >NCBI__GCF_000013905.1:WP_041753416.1 Length = 479 Score = 83.2 bits (204), Expect = 2e-20 Identities = 59/216 (27%), Positives = 103/216 (47%), Gaps = 9/216 (4%) Query: 7 PASEEGIASVVRSAAAERVTLAVVGGGTRAGLGNPV-RADRTLSTRRLSGIVTYDPAEMT 65 P S + + ++V+ A + + GG T G + +S +++ IV + PA+ Sbjct: 62 PKSTKQVQALVKLANEYNIVITPSGGRTGLSAGAVASNGEIVVSLDKMNKIVQFYPADRL 121 Query: 66 MSALAGTPVAEVEAALHAKGQMLSFEPMDHRPIFATTGEPTIGGVFAANVSGPRRYVAGA 125 + AG A+++ A+ + P+D FA+ G IGG N G + G Sbjct: 122 VEVEAGVITAQLQQFAEAQDL---YYPVD----FASAGSSQIGGNIGTNAGGIKVIRYGM 174 Query: 126 ARDSLLGVRFVNGRGEPIKAGGRVMKNVTGLDLVKLMAGSYGTLGILTEVTFKVLPLPPA 185 R ++G+ V G+G+ +K ++KN TG DL +L G+ GTLGI+TE K L PP Sbjct: 175 TRQWVMGLTVVTGKGDILKLNRGMIKNATGYDLRQLFIGAEGTLGIVTEAQMK-LNRPPQ 233 Query: 186 AATVVVSGLNDAEAAAVMAEAMAQPVEVSGASHLPE 221 TV+V G+++ + + A ++++ E Sbjct: 234 DLTVMVLGMDEFDHVMQVLAAFQAQIDLTAFEFFDE 269 Lambda K H 0.318 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 479 Length adjustment: 32 Effective length of query: 373 Effective length of database: 447 Effective search space: 166731 Effective search space used: 166731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory