Align gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_011809698.1 VEIS_RS09480 aldehyde dehydrogenase family protein
Query= reanno::WCS417:GFF5420 (497 letters) >NCBI__GCF_000015565.1:WP_011809698.1 Length = 501 Score = 338 bits (868), Expect = 2e-97 Identities = 194/480 (40%), Positives = 270/480 (56%), Gaps = 9/480 (1%) Query: 23 YINGEYTAAVSGDTFECISPVDGRLLATVASCDAADAQRAVENARATFNSGVWSRLAPAK 82 YI G++ G + + P RLL A AAD Q+A+ AR F+ G W + Sbjct: 14 YIAGQWVQPEGGRYRDIVDPATERLLTQAAEAGAADVQQAIAAARRAFDEGPWRDSGTRE 73 Query: 83 RKSAMLRFAALLKANAEELALLETLDMGKPISDSLNIDVPGAANALSWSGEAIDKIYDEV 142 R + R A + A+AE LA LE+L+ GK IS+S D+ A + + V Sbjct: 74 RARWLHRIAEAIAADAEHLATLESLNTGKTISES-RTDMGDIAATFRYFAALVATASGRV 132 Query: 143 AATPHDQLGLVTREPVGVVGAIVPWNFPLMMACWKLGPALSTGNSVILKPSEKSPLTAIR 202 P + REPVGV G I PWN+PL+ A WKL PAL GN+V+LKPSE +PL+ R Sbjct: 133 NEAPPHVISRTLREPVGVCGLITPWNYPLLQAAWKLAPALGAGNTVVLKPSELTPLSTHR 192 Query: 203 IAALAVEAGIPKGVFNVLPGYGHTVGNALALHMDVDTLVFTGSTKIAKQLLIRSGESNMK 262 +A L ++ G+P GVFN++ G G G LA H +VD L FTG +A ++ + N K Sbjct: 193 LAELLIDIGLPPGVFNLVTGSGEA-GAELARHREVDLLSFTGGA-LAGAAVMNAASGNFK 250 Query: 263 RVWLEAGGKSPNIVFADAPDLQAAAESAAGAIAFNQGEVCTAGSRLLVERSIKDKFLPLV 322 ++ LE GGK+PNIVF DA D A + A A F+ G+VC+AGSRL+V+ I D+F+ + Sbjct: 251 KLALELGGKNPNIVFDDA-DFDTALDYALNAAFFHAGQVCSAGSRLMVQSGIHDRFVDAL 309 Query: 323 IEALKGWKPGNPLDPATNVGALVDTQQMNTVLSYIEAGHADGAKLVAGGKRTLEETGGTY 382 + + + GN T +G + Q V++ + AG GA L GGK + G T+ Sbjct: 310 VARTRRIRLGNGFADGTQMGPVQSALQRQKVMAMVAAGVEQGAVLRCGGKAPAAQAGQTF 369 Query: 383 -----VEPTIFDGVTNAMKIAKEEIFGPVLSVITFDSAEEAVAIANDTIYGLAAAVWTAD 437 +EP + V M +A EEIFGPVL+V F S +EA+ AN T +GLAAAVWT D Sbjct: 370 GRGFWLEPAVLTNVRAEMALATEEIFGPVLTVERFGSEQEALRHANATPFGLAAAVWTRD 429 Query: 438 ISKAHLTAKALRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKATWIKL 497 + +A+ ++ALR G+VW N Y AP+GG+K SG GR+ D+YTELK ++I L Sbjct: 430 LDRANRVSRALRFGTVWANDYHPYFPEAPWGGYKASGIGRELGPGGLDEYTELKHSYINL 489 Lambda K H 0.316 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 619 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 501 Length adjustment: 34 Effective length of query: 463 Effective length of database: 467 Effective search space: 216221 Effective search space used: 216221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory