Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_011809410.1 VEIS_RS08020 NADP-dependent malic enzyme
Query= curated2:P39197 (318 letters) >NCBI__GCF_000015565.1:WP_011809410.1 Length = 774 Score = 150 bits (379), Expect = 1e-40 Identities = 121/332 (36%), Positives = 169/332 (50%), Gaps = 30/332 (9%) Query: 1 MKPLDRIHEAAKALDRHIILPEGEDPRVAEAARRLLAAGLARVTLMGGPEIPGAGRIDPA 60 MKP+ A A + + EGE+ RV AA+ ++ +AR TL+G P I A RI+ Sbjct: 445 MKPI--FMAAKSAAKKRVAYAEGEEERVLRAAQIVVDERIARPTLIGRPAII-ARRIEKF 501 Query: 61 G-----GPDLAELA---DH--------WHRMRAARGMTAERALTEMRDPIRQ-AAMRVRL 103 G G D + DH +HRM +G+T A EMR + AM + Sbjct: 502 GLRLQEGRDYDVVNVENDHRYRLFWQTYHRMTERKGVTVSIAKIEMRRRLTLIGAMLLHQ 561 Query: 104 GQADGTVGGAVATTADTVRAALQIIGKAPGAGIVSSFFLMLSCGPGAPVRGGMIF-ADCG 162 G+ DG + G TA + +IGK G V++F +C G + +F D Sbjct: 562 GEVDGLIVGTWGHTAHHLNYIEPVIGKRAG---VNNF----ACMNGLLLPERQVFLVDTH 614 Query: 163 LVIQPDARELAAIALSAADSCRRILAEEPRVALLSFSTAGSAEHPSLGRIREALALIRAA 222 + P A +LA I + AA+ R P+ ALLS S GS+ PS ++R+AL L+RA Sbjct: 615 VNYDPSAGQLAEITVLAAEEMMRF-GIRPKAALLSHSNFGSSNQPSAVKMRQALELLRAQ 673 Query: 223 APGLEVDGEMQFDAALDEAIRARKAPESPLTGRPNVFVFPDLADGNIGYKIAERLA-GLT 281 AP LEVDGEM D ALD RA P S L G N+ V P++ NI Y + + A G Sbjct: 674 APWLEVDGEMHGDVALDGKARAATMPHSELLGDANLLVLPNIDAANISYNLLKTAAGGNI 733 Query: 282 AIGPILQGLAKPANDLSRACSVKDIVNATAIT 313 AIGP+L G A+P + L+ + +V+ IVN TA+T Sbjct: 734 AIGPVLLGAARPVHILTASTTVRRIVNMTALT 765 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 774 Length adjustment: 34 Effective length of query: 284 Effective length of database: 740 Effective search space: 210160 Effective search space used: 210160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory