Align Putrescine transport system permease protein PotI (characterized)
to candidate WP_011808615.1 VEIS_RS04015 ABC transporter permease subunit
Query= SwissProt::P0AFL1 (281 letters) >NCBI__GCF_000015565.1:WP_011808615.1 Length = 295 Score = 254 bits (649), Expect = 2e-72 Identities = 124/265 (46%), Positives = 179/265 (67%), Gaps = 1/265 (0%) Query: 16 LLLGFTFLYAPMLMLVIYSFNSSKLVTVWAGWSTRWYGELLRDDAMMSAVGLSLTIAACA 75 L LG+ FLY P+ L+++SFN SK+V +W G++ +WY + D ++ + LSL IA + Sbjct: 10 LSLGYLFLYLPIFTLIVFSFNDSKMVALWGGFTLKWYDLVASDTEVIDGLKLSLKIALLS 69 Query: 76 ATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAIGWP 135 AT++ +LG +AA +V++ +FRG F I APLV+P+VITG+SLLL FV G P Sbjct: 70 ATSSVLLGMLAAFAMVKYKKFRGRTAFIAHINAPLVVPEVITGVSLLLFFVMCERMFGLP 129 Query: 136 ADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMP 195 +RG+ TIW H + AY AVVI SRL E+D+S+EEAAMDLG P +VF ++TLPMI Sbjct: 130 -ERGLFTIWAGHTSVGMAYAAVVIQSRLTEMDKSLEEAAMDLGCRPFQVFTLVTLPMIAQ 188 Query: 196 AIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGAVGI 255 +++S WLL FT+SLDD+V+ +F+SGPG+TTLP+++ S R+G+NP IN +ATL + V + Sbjct: 189 SLLSSWLLTFTISLDDVVLTAFLSGPGSTTLPIVILSRARLGLNPTINVVATLTVAVVSV 248 Query: 256 VGFIAWYLMARAEKQRIRDIQRARR 280 M R E++R + A R Sbjct: 249 AVLAGSLWMLRQERKRAAEQAAAYR 273 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 295 Length adjustment: 26 Effective length of query: 255 Effective length of database: 269 Effective search space: 68595 Effective search space used: 68595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory