Align 2-aminomuconate 6-semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate WP_011807992.1 VEIS_RS00900 aldehyde dehydrogenase
Query= metacyc::MONOMER-13361 (500 letters) >NCBI__GCF_000015565.1:WP_011807992.1 Length = 478 Score = 318 bits (816), Expect = 2e-91 Identities = 175/467 (37%), Positives = 265/467 (56%), Gaps = 8/467 (1%) Query: 31 SASSFANINPVNGKLISDVFEADAKQVNEAVVAAQNALK-GPWGKLSVQDRAALIHKIAD 89 +AS +I+P NG I+ V A++++ V A NA + W L RA ++H IAD Sbjct: 6 AASELISIDPANGAEIARVRITSAQELDAVVARAWNAFRHSGWKSLLPHQRALVLHAIAD 65 Query: 90 GIQARFEEFVAAEVADTGRPVHQARTLDIPRAIANFRTFADLAKTSHTDLFEMSTSDGSG 149 G+ A + ++ D G+P + R++ + AI FR +A + +T TD+ T Sbjct: 66 GLAAEKQALARLQMQDNGKPWGECRSM-VESAIGTFRYYAGVCETLQTDV----TPVRGD 120 Query: 150 ALNYTVRKPLGVIGVISPWNLPLLLFTWKVAPALACGNTVVAKPSEESPSSATLLAEVMH 209 +++TV +P GV+ I+PWN P++ KVAPALA GN V+ KPSE++P A LA + H Sbjct: 121 YVSFTVLEPFGVVAAITPWNSPIMNDATKVAPALAAGNAVILKPSEDAPLLAPELARIAH 180 Query: 210 DAGVPPGVFNLIHGFGKDSAGEFLTQHPGISALTFTGESKTGSTIMKAVADGVKEVSFEL 269 AG+P + ++ G G D G L H G+ ++FTG + +G I A A+ + + EL Sbjct: 181 AAGLPEHLLQVVQGRGAD-VGAALVSHHGVRMISFTGGTDSGKAIAHAAAERLVPAALEL 239 Query: 270 GGKNAAVVFADADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFVSGLKVEAERL 329 GGK+ +VFADA + A+ V+ F ++GQ C+ R+++ ++ E ++ + +A RL Sbjct: 240 GGKSPHIVFADAHREHAVAAVVAGIFGSAGQSCVAGSRLFIEECVYAEVLAQVVAQARRL 299 Query: 330 VVGYPDQDGVNMGPLISHGHRDKVLSYYRLAVDEGATVVTGGGVPKFNDERDQGAYVQPT 389 V PD +GV MGPL S HR++V+ + A EGA V+ GG VP E GAY PT Sbjct: 300 RVAPPDAEGVEMGPLASLRHRERVIRFVARARAEGAQVLCGGAVPA-GAEFTAGAYYLPT 358 Query: 390 IWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGLACAIWTTNLSRAHRVSR 449 + GL +A EE FGPV F DE ++I++ N + +GLAC IWT N +A R+ R Sbjct: 359 VIDGLHPRAATCQEEAFGPVLVAFAFRDEADLIDQANGTAFGLACGIWTENFKKAWRIGR 418 Query: 450 QIHVGLVWVNTWYLRDLRTPFGGVKLSGLGREGGRFSMDFYSDIANI 496 + G VW+NT+ TPFGGVK SG+GRE G + Y+ + ++ Sbjct: 419 ALEAGSVWINTYKQSVASTPFGGVKSSGIGREKGIDGLKLYTQVKSM 465 Lambda K H 0.318 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 478 Length adjustment: 34 Effective length of query: 466 Effective length of database: 444 Effective search space: 206904 Effective search space used: 206904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory