GapMind for catabolism of small carbon sources

 

Protein WP_011974043.1 in Methanococcus aeolicus Nankai-3

Annotation: NCBI__GCF_000017185.1:WP_011974043.1

Length: 238 amino acids

Source: GCF_000017185.1 in NCBI

Candidate for 26 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 44% 90% 164.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 42% 90% 164.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 42% 90% 164.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-glutamate catabolism gltL med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 42% 90% 164.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 41% 84% 159.8 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 41% 84% 159.8 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-histidine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 42% 81% 146.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 40% 87% 146.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 42% 81% 146.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 42% 90% 146 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 42% 90% 146 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 39% 85% 153.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 40% 89% 149.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 37% 91% 148.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 148.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-lysine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 148.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 35% 89% 141.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 34% 71% 136.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 37% 82% 136 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 87% 117.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 50% 208.0

Sequence Analysis Tools

View WP_011974043.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MGQNENKIENKIEKKELIEAKNIWKIYGGGEAKTVVLRGINLKIKEGEFVAIMGPSGCGK
STLLNILGLLDVPNKGMVYIKGKKTTMFSENDRAVFRRKISGFIFQQFNLINTLTALENV
ELPLVLDEKNKNYRIKKAKKLLKIINLGHRENYYPNQLSGGQQQRVAIARALSNNPKIIF
ADEPTGNLDSKNSREVMDILKELNEKEGITVIMVTHEPEFAKYASRIINMKDGEIVEH

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory