Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_012275459.1 SHAL_RS01660 aldehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >NCBI__GCF_000019185.1:WP_012275459.1 Length = 506 Score = 352 bits (904), Expect = e-101 Identities = 203/477 (42%), Positives = 278/477 (58%), Gaps = 14/477 (2%) Query: 23 FINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAPAK 82 FI GE+ V+ F+ SPVDG+ +V D A++ A +S W + + + Sbjct: 22 FIGGEWVKPVNDLYFDNTSPVDGQVFCQVPRSGSVDIELALDAAHEAKDS--WGKTSVTE 79 Query: 83 RKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYDEV 142 R L+R AD + +N+E LA+ ET D GK + ++ D+P + A I Sbjct: 80 RANILLRIADRIEQNIEPLAIAETWDNGKAVRETLVADLPLVVDHFRYFAGCIRAQEGSA 139 Query: 143 APTPHDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLTAIR 202 A + + EP+GVVG I+PWNFPLLMA WK+ PALA GN +VLKP+E++P + + Sbjct: 140 ADIDANTVSYHFPEPLGVVGQIIPWNFPLLMAAWKIAPALAAGNCIVLKPAEQTPASILV 199 Query: 203 IAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNMK 262 + +L IE +P GVLNV+ G+G G+ALA ++ L FTGST++ + ++ A ES + Sbjct: 200 LLEL-IEDLLPKGVLNVVNGFGTEAGQALATSSRINKLAFTGSTQVGQHILKCAAESLIP 258 Query: 263 RIWLEAGGKSPNIVFADAPD-----LQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDK 317 +E GGKSPNI FAD D L A E A FNQGEVCT SR L+ SI DK Sbjct: 259 ST-VELGGKSPNIYFADVMDHEDEYLDKAVEGMLLAF-FNQGEVCTCPSRALIHESIYDK 316 Query: 318 FLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGG---KRT 374 F+ V++ K K NPLD T VGA +Q + +LSY++ G +GA++L GG K Sbjct: 317 FIAKVIQRAKTIKQSNPLDTDTQVGAQASQEQFDKILSYLDIGKDEGAEVLIGGNICKLE 376 Query: 375 LEETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIW 434 E++ G Y+ PTI G TN MRI QEEIFGPV+SV F EA+AIANDT YGL AG+W Sbjct: 377 GEQSQGFYITPTILKG-TNDMRIFQEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVW 435 Query: 435 TSDISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELK 491 T D++ A + R ++AG VW+N Y A FGG+K+SG GR+ L+ Y K Sbjct: 436 TRDMNTAQRMGRGIQAGRVWINCYHAYPAHAAFGGYKKSGIGRETHKMMLDHYQNTK 492 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 622 Number of extensions: 35 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 506 Length adjustment: 34 Effective length of query: 463 Effective length of database: 472 Effective search space: 218536 Effective search space used: 218536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory