Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_041416422.1 SHAL_RS12630 ATP-binding cassette domain-containing protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000019185.1:WP_041416422.1 Length = 248 Score = 112 bits (280), Expect = 7e-30 Identities = 69/227 (30%), Positives = 122/227 (53%), Gaps = 19/227 (8%) Query: 8 VLLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIE 67 ++L++KGL YG + A+K + ++ GE+V+L+G NGAGK+T +K I+G + G++ Sbjct: 1 MVLELKGLNKQYGPVDALKNISLAIQPGEVVALLGDNGAGKSTLIKVISGAEAFCSGSLS 60 Query: 68 YLGKSIKGKG--AWDLVKEGLVMVPEGRGVFARMTITENLQMGAYI------------RK 113 +GK++ KG + G+ V + + + ++ NL +G ++ RK Sbjct: 61 IMGKTVSAKGYCVQKARQLGIETVYQSGSLGEQQSVWRNLFLGRHLHNRFGFIDHKEERK 120 Query: 114 DKAGILADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGL 173 +L +E F + D A +SGGE+Q LA+GRA++ K+++LDEP+ L Sbjct: 121 QAKALLERLE-----FNGIGANVDTPAQLLSGGERQGLAIGRAMLFGAKLVILDEPTTAL 175 Query: 174 SPIMVDKIFEVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLI 220 S VDK+ + + + + +L+ N + A +ADR VM+ G I Sbjct: 176 SLGEVDKVLKFIEKLKSQDSACLLITHNMNDAYRVADRFVVMDRGSI 222 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 248 Length adjustment: 24 Effective length of query: 218 Effective length of database: 224 Effective search space: 48832 Effective search space used: 48832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory