Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_041416422.1 SHAL_RS12630 ATP-binding cassette domain-containing protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_000019185.1:WP_041416422.1 Length = 248 Score = 149 bits (377), Expect = 4e-41 Identities = 96/250 (38%), Positives = 138/250 (55%), Gaps = 11/250 (4%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 ++ ++G+ K +G V AL +S+ + PGE LLGDNGAGKST IK +SG G + Sbjct: 2 VLELKGLNKQYGPVDALKNISLAIQPGEVVALLGDNGAGKSTLIKVISGAEAFCSGSLSI 61 Query: 67 EGQPLHFAD--PRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYA 124 G+ + + A GI TV+Q ++ SV RN F+G + G + + Sbjct: 62 MGKTVSAKGYCVQKARQLGIETVYQSGSLGEQQSVWRNLFLGRHLHNRFGFIDHKEERKQ 121 Query: 125 NRITME--EMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVR 182 + +E E +G N+ P Q LSGGERQ +AI RA+ FGAK++ILDEPT+AL + Sbjct: 122 AKALLERLEFNGIGANVDTPAQL---LSGGERQGLAIGRAMLFGAKLVILDEPTTALSLG 178 Query: 183 QTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQ- 241 + VL I+K++ Q A + ITHN+ A V DRF V++RG + + DIS LQ Sbjct: 179 EVDKVLKFIEKLKSQDSACLLITHNMNDAYRVADRFVVMDRGSIIAQYHKSDISQAGLQQ 238 Query: 242 ---DMMAGGQ 248 D + GGQ Sbjct: 239 ALLDAVGGGQ 248 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 248 Length adjustment: 24 Effective length of query: 237 Effective length of database: 224 Effective search space: 53088 Effective search space used: 53088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory