Align long-chain-aldehyde dehydrogenase (EC 1.2.1.48) (characterized)
to candidate WP_012278495.1 SHAL_RS17760 coniferyl aldehyde dehydrogenase
Query= BRENDA::P51648 (485 letters) >NCBI__GCF_000019185.1:WP_012278495.1 Length = 475 Score = 285 bits (729), Expect = 2e-81 Identities = 161/444 (36%), Positives = 252/444 (56%), Gaps = 14/444 (3%) Query: 9 RQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLC-KSEFNVYSQEVITVLGE 67 R +L+ + R++ L++L+ + ++ ++ A+ D +S + +++ + Sbjct: 21 RSCYLNEPAPAYDARVEYLKSLKAAILSHQEQLVAALNRDYGNRSVDDSMISDIMPCINN 80 Query: 68 IDFMLENLPEWVTAKPVKKNVLTMLDEAYIQP--QPLGVVLIIGAWNYPFVLTIQPLIGA 125 I++ L++L +W+ KP ++ +L A I+ QPLGVV II WN+P +L++ PLI A Sbjct: 81 INYSLKHLKKWM--KPSSRHAGLLLAPAKIKVHYQPLGVVGIIVPWNFPVMLSVGPLITA 138 Query: 126 IAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTG 185 +AAGN +IK SE + T +++ +L D + I G E E FDH+ +TG Sbjct: 139 LAAGNRAMIKLSEFTPETNQVIKTMLSSIFDDTHVVCIEGEAEVAAEFSALPFDHLLFTG 198 Query: 186 NTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPD 245 +T VG+ VM AAA +LTPVTLELGGKSP I D D+ R+ +GK +N GQ C+APD Sbjct: 199 STTVGRHVMRAAADNLTPVTLELGGKSPVIIADDIDMATAVERMIYGKCLNAGQICVAPD 258 Query: 246 YILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQK---IAF 302 Y+L + + + K+ YG+ + ++ DY +IN R F RI+ +LE K Sbjct: 259 YVLLPRAKVDSFIQAYKKKFSRMYGK-VSDNKDYGSVINQRQFDRIMHVLEDAKAKGATI 317 Query: 303 GGETDEA----TRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKP 358 DEA R + ++ + ++QEEIFGP+LP++P N++EAI +IN+R +P Sbjct: 318 TSANDEAINTDKRKVPTQLIQNSSDDMLLLQEEIFGPLLPVIPYDNLEEAIAYINQRPRP 377 Query: 359 LALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDT 418 LALY+ S + + +R++ T SGGV N+ + H + PFGG+G SGMG YHGK F T Sbjct: 378 LALYLMSFDKDIQQRVLANTHSGGVCINETVFHVAADDAPFGGIGPSGMGHYHGKEGFLT 437 Query: 419 FSHQRPCLLKSLKREGANKLRYPP 442 SH + L + K KL +PP Sbjct: 438 LSHAKTVLSRG-KYLNTGKLVHPP 460 Lambda K H 0.321 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 547 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 475 Length adjustment: 34 Effective length of query: 451 Effective length of database: 441 Effective search space: 198891 Effective search space used: 198891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory