Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_041416422.1 SHAL_RS12630 ATP-binding cassette domain-containing protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_000019185.1:WP_041416422.1 Length = 248 Score = 157 bits (397), Expect = 2e-43 Identities = 93/239 (38%), Positives = 138/239 (57%), Gaps = 9/239 (3%) Query: 6 ILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRL 65 +L +GL K+YG V AL + PGE++A++GDNGAGKS++IK ISGA G + + Sbjct: 2 VLELKGLNKQYGPVDALKNISLAIQPGEVVALLGDNGAGKSTLIKVISGAEAFCSGSLSI 61 Query: 66 EGKPIQFRS--PMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDR 123 GK + + +ARQ GIETVYQ+ +L S+ N+FLGR + F +D Sbjct: 62 MGKTVSAKGYCVQKARQLGIETVYQSGSLGEQQSVWRNLFLGRHLHNR------FGFIDH 115 Query: 124 AAMEKQARAKLSELGLMTI-QNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAAL 182 KQA+A L L I N++ + LSGG+RQG+A+ RA FG+K+VI+DEPT AL Sbjct: 116 KEERKQAKALLERLEFNGIGANVDTPAQLLSGGERQGLAIGRAMLFGAKLVILDEPTTAL 175 Query: 183 GVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMS 241 + E +VL+ I ++ + +LI+HNM + VADR + G + + D + + Sbjct: 176 SLGEVDKVLKFIEKLKSQDSACLLITHNMNDAYRVADRFVVMDRGSIIAQYHKSDISQA 234 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 248 Length adjustment: 24 Effective length of query: 236 Effective length of database: 224 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory