Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_012645250.1 GEOB_RS00720 phosphate butyryltransferase
Query= curated2:Q9X448 (316 letters) >NCBI__GCF_000022265.1:WP_012645250.1 Length = 301 Score = 199 bits (507), Expect = 5e-56 Identities = 123/295 (41%), Positives = 169/295 (57%), Gaps = 5/295 (1%) Query: 12 YDRLIAAARAEAPAVTIVAHPCDETSLGGAIEAAEMGLITPILVAPEAKIRNVAAEHRLD 71 +D LI A + + + P T + +A E L ILV E KI+ ++AE D Sbjct: 5 FDELITAVQEKPRKKIAIVSPEGSTVMKLVKQALEAKLADFILVGDEEKIKTMSAEAGFD 64 Query: 72 LGRREIVDVPHSHAAAAKAVALIREGRGELLMKGSLHTDELMHEVAASATGLRTQRRISH 131 I+++ AA +AV L+ G +MKG+L T M + GL + IS Sbjct: 65 ANLINIINIIDQKEAAEEAVRLVVVGSANAIMKGNLPTATFMRAILDKQKGLNDNKVISE 124 Query: 132 VFV----MDVPGHTDTLFITDAAINIFPDLEAKRDIVQNAIDLWVAIGLGEPRVAILSAV 187 + + +D PG FITD AIN+ P L+ K+ I++NA+ L +G P+VA++SAV Sbjct: 125 ITIYEKIVDAPGG-GFRFITDCAINVSPTLDEKKQIIENAVGLAHKLGNDLPKVAVISAV 183 Query: 188 ETVTAKIPSTIEAAALCKMAERGQITGGVLEGPLAFDNAIDQEAARIKGINSPVAGHAQI 247 E V +P TIEAAAL KMAERGQI G ++EGPLAFDNAI E+AR K I VAG A I Sbjct: 184 EVVNPAMPDTIEAAALSKMAERGQIEGCLIEGPLAFDNAISVESARYKKIKGEVAGQADI 243 Query: 248 LVVPDLEAGNMLAKNLTFLTHADAAGLVLGARVPIVLTSRADSVRTRLASCAVAA 302 +++P+L + N L K L + T A V+GA+ PIVLTSR+DS T L + A+AA Sbjct: 244 IMMPNLLSANPLRKCLVYYTQQRIATAVMGAKAPIVLTSRSDSADTMLLTIALAA 298 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 301 Length adjustment: 27 Effective length of query: 289 Effective length of database: 274 Effective search space: 79186 Effective search space used: 79186 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory