Align acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized)
to candidate WP_012645344.1 GEOB_RS01200 acetyl-CoA C-acetyltransferase
Query= reanno::pseudo5_N2C3_1:AO356_21640 (393 letters) >NCBI__GCF_000022265.1:WP_012645344.1 Length = 391 Score = 393 bits (1010), Expect = e-114 Identities = 209/392 (53%), Positives = 268/392 (68%), Gaps = 2/392 (0%) Query: 1 MQEVVIVAATRTAIGSFQGSLAAIPAPELGAAVIRRLLEQTGLSGEQVDEVILGQVLTAG 60 M EV IV + RT +GSF G+LA + AP L AAVI+ LLE+ LS E VDEVI+GQVL+ G Sbjct: 1 MSEVFIVESLRTPLGSFGGALADVDAPRLAAAVIKELLERAALSPEAVDEVIIGQVLSGG 60 Query: 61 SGQNPARQASILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL 120 SGQ PARQA GLP +VPA+T+NKVCGSGLKA+ LGA AIR GDA V++AGGMENMS Sbjct: 61 SGQAPARQALRYGGLPDSVPAMTINKVCGSGLKAIMLGADAIRLGDAHVVLAGGMENMSQ 120 Query: 121 APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREEQDAFAA 180 APY LP AR G RMG+ +++D M+ DGL D ++ HMG+ AE K G+SR EQD FA Sbjct: 121 APYALPKARNGFRMGNGEVVDLMVNDGLLDPYSGNHMGVIAEANAAKNGLSRAEQDEFAV 180 Query: 181 ASQQKAVAAIEGGRFADEITPILIPQRKGDPVAFATDEQPRAGTTAESLGKLKPAFKKDG 240 AS +KA AA++ G F DEI P++ R+G+ V A DE+P G + G L+ AF K+G Sbjct: 181 ASYKKAQAAVKDGVFKDEIVPVVKKGRQGE-VVIAEDEEPLKGDIGKLPG-LRAAFAKEG 238 Query: 241 SVTAGNASSLNDGAAAVILMSAEKAKALGLPVLAKISAYANAGVDPAIMGIGPVSATRRC 300 ++TAGNAS++NDGA +L S E K L A++ AYA + P + PV A + Sbjct: 239 TITAGNASTINDGAGIALLASGEAVKKYNLKPKARLLAYATNSIHPDLFTEAPVGAIEKA 298 Query: 301 LDKAGWSLEQLDLIEANEAFAAQSLAVARELKWDMDKVNVNGGAIALGHPIGASGCRVLV 360 L KAG + +DL E NEAFA L ++L D +VNVNGGA+A+GHP+GASG R+ Sbjct: 299 LVKAGLKVGDIDLFELNEAFATVPLLAIKKLGIDPARVNVNGGAVAIGHPLGASGARLAA 358 Query: 361 SLLHEMIKRDAKKGLATLCIGGGQGVALALER 392 +L+ E+ KR+A+ GLATLCIGGG+ VA ER Sbjct: 359 TLIRELHKRNARYGLATLCIGGGEAVAAIFER 390 Lambda K H 0.317 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 391 Length adjustment: 31 Effective length of query: 362 Effective length of database: 360 Effective search space: 130320 Effective search space used: 130320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory