Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_012645341.1 GEOB_RS01185 NADP-dependent malic enzyme
Query= curated2:Q59330 (328 letters) >NCBI__GCF_000022265.1:WP_012645341.1 Length = 755 Score = 243 bits (620), Expect = 1e-68 Identities = 140/330 (42%), Positives = 200/330 (60%), Gaps = 12/330 (3%) Query: 4 IQSIIEKAKSNKKKIVLPEGAEPRTLKAADIVLKEGIADLVLLGNADEIRNAAE--GLDI 61 ++ II KAK + K IV PEG + L+AA +++++GIA +LLG+ +IR + G+D+ Sbjct: 428 LRMIINKAKCDPKSIVFPEGENEKILRAAQVLVEQGIARPILLGSEKKIRATLQELGIDL 487 Query: 62 SKA-EIIDPLKSEKFDKYATDFYELRKNKGITLEKAKETI--KDNIYFGCMMVKEGYADG 118 + IIDP S+K + YA +FY LR+ KG+TL +++ + K +FGCMMV++G AD Sbjct: 488 NGGVTIIDPANSDKANGYADEFYRLRQRKGLTLSESQRLMSRKSRTHFGCMMVRQGDADT 547 Query: 119 LVSGAIHATADLLRPAFQIVKTAPGAKIVSSFFIMEVPNCEFGENGVFLFADCAVNPSPN 178 L++G A+ +RPA Q++ G V +IM + G++ AD V PN Sbjct: 548 LLAGIDANYAETIRPALQVIGKQEGLSSVHGLYIMVF------KKGLYFLADTTVCIDPN 601 Query: 179 AEELASIAVQSANTAKTLLGMEPRVAMLSFSTKGSASHELVDKVRTATEIAKNLIPDVAI 238 A+ELA A+ +A A+ +L +EP VAMLS S GS H DKVR A E+ K P + I Sbjct: 602 AQELAETAILTAEMAR-MLEVEPSVAMLSMSNFGSVRHPQADKVRLAVELVKEKEPGLII 660 Query: 239 DGELQLDAALVKEVAELKAPGSPVAGRANVLIFPDLQAGNIGYKLVQRLAKANAIGPITQ 298 DGE+Q D A+V E+ + P S + AN+LIFPDL +GNI YKL+ +L +A AIGPI Sbjct: 661 DGEMQADTAVVTEILQSSFPFSTLKKAANILIFPDLTSGNIAYKLLNKLGEAEAIGPILM 720 Query: 299 GMGAPVNDLSRGCSYKDIVDVIATTAVQAQ 328 GM PV+ L RG DIV++ A V AQ Sbjct: 721 GMNKPVHILQRGDDVMDIVNMAAIAVVDAQ 750 Lambda K H 0.315 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 755 Length adjustment: 34 Effective length of query: 294 Effective length of database: 721 Effective search space: 211974 Effective search space used: 211974 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory