Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_012647180.1 GEOB_RS10430 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000022265.1:WP_012647180.1 Length = 223 Score = 100 bits (250), Expect = 2e-26 Identities = 71/221 (32%), Positives = 113/221 (51%), Gaps = 9/221 (4%) Query: 11 LLQVNGVETYYGN----IRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTG 66 LL+V+ + YG+ + L G+ ++V GE ++L+GA+GAGKSTLM + +G Sbjct: 4 LLEVSDLYKSYGSGAGKVEVLKGISLNVTAGETIALVGASGAGKSTLMHVLGTIDTPTSG 63 Query: 67 SVVFEGRDITRMPTHEIARLR---IAQSPEGRRIFPRMTVLENLQMGAGLDNLKHF-AED 122 V F+G +I ++ +A R I + + P T LEN M + K AE Sbjct: 64 VVKFDGEEIFKLGGAALASFRNLSIGFVFQFHHLLPEFTALENAMMPLLIGGTKRSEAEP 123 Query: 123 VEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGI 182 + L R + G LSGGEQQ ++I RAL+ PKLLL DEP+ L + Sbjct: 124 IAAGLLRDVGLSHRLTHKPGELSGGEQQRVAIARALVRSPKLLLADEPTGNLDMKTSDEV 183 Query: 183 FEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVT 223 + + ++ GLT+ +V N A +++ R MV+G+++ Sbjct: 184 HDLLMDIHVKRGLTLIIVTHNEKLAAKMA-RTIRMVDGRIS 223 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 223 Length adjustment: 23 Effective length of query: 224 Effective length of database: 200 Effective search space: 44800 Effective search space used: 44800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory