Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_012647879.1 GEOB_RS13895 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000022265.1:WP_012647879.1 Length = 251 Score = 176 bits (446), Expect = 4e-49 Identities = 93/249 (37%), Positives = 150/249 (60%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L +G+ + FGG+ A+D + G ITG+IGPNGAGKTTLFN+++ G V+ Sbjct: 1 MLEIRGIKQVFGGVTALDDVSFTMHRGDITGVIGPNGAGKTTLFNIITGIYTRTAGAVIL 60 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 + I L ++A G VRTFQ ++ +++TVLEN+++ ++ L + Sbjct: 61 DDHDISDLPAERLAGLGMVRTFQNIELFAKMTVLENVMVGLHSRSKCGMLSCALRMPWAV 120 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 EER R +AM LE G+ AQ AG L G+ +LLE+ARA+ P+++L+DEPAAG+ Sbjct: 121 AEERRIRSEAMGWLEFAGIAELAQVEAGNLPFGKGRLLELARAMACEPRILLMDEPAAGL 180 Query: 198 NPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSDP 257 N + + I +G++ +++EH+M+++M +C + VL G+ LA+GTP +IQ + Sbjct: 181 NSQETLGLAKLIRAIRDKGVSVVLVEHDMELVMDICDRIVVLNLGKKLAEGTPREIQENA 240 Query: 258 RVLEAYLGD 266 V+ AYLG+ Sbjct: 241 EVISAYLGE 249 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 251 Length adjustment: 24 Effective length of query: 243 Effective length of database: 227 Effective search space: 55161 Effective search space used: 55161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory