Align TM1748, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_012648104.1 GEOB_RS15070 ABC transporter permease
Query= TCDB::Q9X270 (289 letters) >NCBI__GCF_000022265.1:WP_012648104.1 Length = 284 Score = 231 bits (589), Expect = 1e-65 Identities = 114/274 (41%), Positives = 171/274 (62%), Gaps = 6/274 (2%) Query: 17 WLRFKKNKMAVIGGVFVLILIALAILAPYIAPYPYDEPHYIRAFE---GPSKDFIFGTDA 73 W RF+ N +A+ G + V I+ ++ LAP I PY +P+ + A+ PS FGTD Sbjct: 13 WRRFRGNPLALSGALVVCIMFLISFLAPAITPY---QPNTLDAYHVLLPPSTSHWFGTDD 69 Query: 74 LGRDLFSRILYSLRNACIIGFGSQFVVLIIGGILGAVAGFKGGWIDKFIMSIVDIMFAFP 133 LGRD+FSR+++ R + +GF + + +IG ++G +AG+ GGW+D +M VDIM FP Sbjct: 70 LGRDVFSRMVFGARVSLKVGFVAIGIATVIGTVVGLIAGYYGGWVDSLLMRFVDIMLCFP 129 Query: 134 TFLFNVILVTALGRGLFTIFLAIGLTGWAGMARLVRGQVLYLKNSEFVEAAKAAGASTFY 193 TF + +VT + I L IG TGW G++RLVR +VL L+ +FV AA+A G S Sbjct: 130 TFFLILAIVTIREPSILNIMLIIGFTGWMGVSRLVRAEVLSLRERDFVLAARAIGCSDLR 189 Query: 194 IIRKHILPNMIGPILVNLAFGVPGAMMTESGLAVIGMGVRPPMPSWGNLIGEGIGMMMAF 253 II +HILPN IGP+LV G+ A++TES L+ +G+GV+PP PSWGN++ G + Sbjct: 190 IIFRHILPNAIGPVLVYATLGIAAAILTESSLSFLGIGVQPPEPSWGNILASGKEFLEFA 249 Query: 254 PHLLIFPAVTFAFTLISFTFLADGLRDAFNPRSE 287 L +FP + T +S+ + +G+RDA +PR++ Sbjct: 250 WWLFLFPGLAITITTLSYYLVGEGIRDALDPRNK 283 Lambda K H 0.331 0.147 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 284 Length adjustment: 26 Effective length of query: 263 Effective length of database: 258 Effective search space: 67854 Effective search space used: 67854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory