Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate WP_041267424.1 GEOB_RS08075 acetate kinase
Query= BRENDA::Q9WYB1 (403 letters) >NCBI__GCF_000022265.1:WP_041267424.1 Length = 421 Score = 439 bits (1128), Expect = e-128 Identities = 225/401 (56%), Positives = 292/401 (72%), Gaps = 3/401 (0%) Query: 1 MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRV-GDEKHVIERELPDH 59 M +L +N GSSS+KYQL + ++V+ KG+ ER+ I S ++H V G E + E E PDH Sbjct: 1 MDILALNCGSSSVKYQLFDWAKKEVIAKGMVERVIIGDSFIMHEVPGRETYREESECPDH 60 Query: 60 EEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLA 119 + A+ LI+ TL D GV+KD+K I A+GHRVVHGGE+F SVL+D++VL A++EV LA Sbjct: 61 QVAIDLIIKTLTDPVHGVLKDIKNISAIGHRVVHGGEKFTCSVLIDDKVLDAVKEVQHLA 120 Query: 120 PLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRRYGFH 179 PLHNP N+ GI+AA +LP VP VA+FDTAFHQT+P+ +YLY +PYE+YEKY +RRYGFH Sbjct: 121 PLHNPPNIAGIEAAQAILPDVPQVAIFDTAFHQTMPEHSYLYPLPYEWYEKYGVRRYGFH 180 Query: 180 GTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGT 239 GTSH YVSKRAA +LGK ++ IIT HIGNG S A+ G VDTSMG TPLEG VMGT Sbjct: 181 GTSHLYVSKRAAVLLGKAPKDTNIITMHIGNGVSHCAIANGVSVDTSMGLTPLEGAVMGT 240 Query: 240 RSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGDEWCK 299 R GD+DPAIP F+M+KE +S +E+ ILNKKSGV G++ F +D R++ E A GD CK Sbjct: 241 RCGDIDPAIPAFMMQKENLSAKEIDSILNKKSGVLGITGRF-TDRREVIEHAGNGDRLCK 299 Query: 300 LVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKN 359 L L+I YR+ KYIG+Y AA+ +DA+VFTAGVGE RE LE LG+KLDK++N Sbjct: 300 LALDIEAYRLRKYIGSYMAAIGKLDAVVFTAGVGEMGWPIREKTIEGLEHLGIKLDKERN 359 Query: 360 EETI-RGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIVE 399 + + R +E +I+T DS VKV V+PT+EEL+ D I+E Sbjct: 360 KSAMTRKRETLITTDDSPVKVYVIPTDEELVFTEDVAAILE 400 Lambda K H 0.318 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 421 Length adjustment: 31 Effective length of query: 372 Effective length of database: 390 Effective search space: 145080 Effective search space used: 145080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_041267424.1 GEOB_RS08075 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.537188.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-159 515.3 0.0 5.4e-159 515.2 0.0 1.0 1 NCBI__GCF_000022265.1:WP_041267424.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000022265.1:WP_041267424.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 515.2 0.0 5.4e-159 5.4e-159 5 402 .. 2 397 .. 1 400 [. 0.98 Alignments for each domain: == domain 1 score: 515.2 bits; conditional E-value: 5.4e-159 TIGR00016 5 kilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkllntlkk 77 il ln+Gsss+k++l+d ++ ++v+++g+ver+ + +++i+ + g ++ +e+ + +dh+ a++ +++tl++ NCBI__GCF_000022265.1:WP_041267424.1 2 DILALNCGSSSVKYQLFDWAK-KEVIAKGMVERVIIGDSFIMHEVPGRETYREESECPDHQVAIDLIIKTLTD 73 69******************5.8899**********************************************9 PP TIGR00016 78 .dkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknv 149 + +lk+ ++i++iGHRvvhGgekft sv+++d+vl+++k++ +lAPlHnp+++ giea++ +l+++++v NCBI__GCF_000022265.1:WP_041267424.1 74 pVHGVLKDIKNISAIGHRVVHGGEKFTCSVLIDDKVLDAVKEVQHLAPLHNPPNIAGIEAAQ--AILPDVPQV 144 899***********************************************************..999****** PP TIGR00016 150 avFDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsa 222 a+FDtafHqt+pe++ylY+lPy++y+++gvRrYGfHGtsh yv++raa ll+k+ +d n+i++H+GnG s +a NCBI__GCF_000022265.1:WP_041267424.1 145 AIFDTAFHQTMPEHSYLYPLPYEWYEKYGVRRYGFHGTSHLYVSKRAAVLLGKAPKDTNIITMHIGNGVSHCA 217 ************************************************************************* PP TIGR00016 223 vknGksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildk 295 + nG s+dtsmGltPLeG vmGtR+GdiDpai +++++++ls++ei ++lnkksG+lgi+g +D R+++++ NCBI__GCF_000022265.1:WP_041267424.1 218 IANGVSVDTSMGLTPLEGAVMGTRCGDIDPAIPAFMMQKENLSAKEIDSILNKKSGVLGITGRFTDRREVIEH 290 ************************************************************************* PP TIGR00016 296 keegneeaklAlkvyvhRiakyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaa 368 +g+ +klAl++ ++R++kyig+y+a++ g+lDa+vFt+G+Ge +re+++e+le lG+kld+e+n+ a NCBI__GCF_000022265.1:WP_041267424.1 291 AGNGDRLCKLALDIEAYRLRKYIGSYMAAI-GKLDAVVFTAGVGEMGWPIREKTIEGLEHLGIKLDKERNKSA 362 ******************************.66**************************************98 PP TIGR00016 369 .rsgkesvisteeskvkvlviptneelviaeDalr 402 ++++e++i+t++s vkv+vipt+eelv eD++ NCBI__GCF_000022265.1:WP_041267424.1 363 mTRKRETLITTDDSPVKVYVIPTDEELVFTEDVAA 397 78899***************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 22.17 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory