Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_012647880.1 GEOB_RS13900 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000022265.1:WP_012647880.1 Length = 247 Score = 256 bits (653), Expect = 4e-73 Identities = 123/238 (51%), Positives = 185/238 (77%), Gaps = 5/238 (2%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 +L+++N++ +YG + A+++VS + +GE+V+LIGANGAGKTTIL T+SG+ + G+I F Sbjct: 1 MLRLKNINTYYGKVHALKNVSIHLGQGEIVTLIGANGAGKTTILNTISGVTPAAGGEILF 60 Query: 63 LGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLK----K 118 + +Q + +IV G++QVPEGR VF L+V +NL++GA+L+ + E ++ ++ + Sbjct: 61 EKEPVQALSPDRIVRLGIAQVPEGRQVFKPLSVEDNLDLGAYLRHRQREAKSRIRQDKQE 120 Query: 119 VFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDI 178 +F+ FPRLEER+ Q A TLSGGEQQMLA+GRA+M+ PKL+LLDEPSMGLAP+ +QEIF + Sbjct: 121 IFTLFPRLEERRKQPAGTLSGGEQQMLAIGRAMMTRPKLMLLDEPSMGLAPLVVQEIFRV 180 Query: 179 IQDIQKQ-GTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 I ++++Q GTT+LL+EQNA AL ++DRGYVLETGK++L G L +++V++AYLG Sbjct: 181 IDNLRRQHGTTILLVEQNAKAALNLADRGYVLETGKVILEGLSSNLLENKDVQRAYLG 238 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 247 Length adjustment: 23 Effective length of query: 213 Effective length of database: 224 Effective search space: 47712 Effective search space used: 47712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory