GapMind for catabolism of small carbon sources

 

Protein WP_012783773.1 in Brucella microti CCM 4915

Annotation: NCBI__GCF_000022745.1:WP_012783773.1

Length: 467 amino acids

Source: GCF_000022745.1 in NCBI

Candidate for 20 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism cycA hi D-serine/D-alanine/glycine transporter (characterized) 59% 98% 570.9 Proline-specific permease (ProY) 41% 366.7
D-serine catabolism cycA hi D-serine/D-alanine/glycine transporter (characterized) 59% 98% 570.9 L-alanine and D-alanine permease 44% 380.2
L-alanine catabolism cycA hi D-serine/D-alanine/glycine transporter (characterized) 59% 98% 570.1 Proline-specific permease (ProY) 41% 366.7
L-threonine catabolism RR42_RS28305 med D-serine/D-alanine/glycine transporter (characterized, see rationale) 46% 95% 418.7 D-serine/D-alanine/glycine transporter 59% 570.9
L-phenylalanine catabolism aroP med Aromatic amino acid transport protein AroP (characterized, see rationale) 42% 95% 371.3 D-serine/D-alanine/glycine transporter 59% 570.9
L-proline catabolism proY med Proline-specific permease (ProY) (characterized) 41% 99% 366.7 D-serine/D-alanine/glycine transporter 59% 570.9
L-tryptophan catabolism aroP med Aromatic amino acid transport protein AroP (characterized, see rationale) 40% 97% 359.8 D-serine/D-alanine/glycine transporter 59% 570.9
L-histidine catabolism permease med histidine permease (characterized) 41% 94% 349 D-serine/D-alanine/glycine transporter 59% 570.9
L-tyrosine catabolism aroP med L-tyrosine transporter (characterized) 40% 96% 349 D-serine/D-alanine/glycine transporter 59% 570.9
phenylacetate catabolism H281DRAFT_04042 lo Aromatic amino acid transporter AroP (characterized, see rationale) 40% 95% 347.1 D-serine/D-alanine/glycine transporter 59% 570.9
L-serine catabolism serP lo Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized) 38% 99% 334 D-serine/L-alanine/D-alanine/glycine/D-cycloserine uptake porter of 556 aas, CycA 55% 545.0
L-threonine catabolism serP1 lo Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) 38% 98% 321.2 D-serine/D-alanine/glycine transporter 59% 570.9
L-asparagine catabolism ansP lo Asparagine permease (AnsP) of 497 aas and 12 TMSs (characterized) 38% 89% 305.8 D-serine/D-alanine/glycine transporter 59% 570.9
L-lysine catabolism lysP lo Lysine permease LysP (characterized) 35% 91% 266.9 D-serine/D-alanine/glycine transporter 59% 570.9
L-arginine catabolism rocE lo Amino-acid permease RocE (characterized) 33% 99% 259.2 D-serine/D-alanine/glycine transporter 59% 570.9
L-isoleucine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 33% 71% 206.1 D-serine/D-alanine/glycine transporter 59% 570.9
L-leucine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 33% 71% 206.1 D-serine/D-alanine/glycine transporter 59% 570.9
L-valine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 33% 71% 206.1 D-serine/D-alanine/glycine transporter 59% 570.9
L-asparagine catabolism AGP1 lo general amino acid permease AGP1 (characterized) 31% 63% 188.3 D-serine/D-alanine/glycine transporter 59% 570.9
L-tryptophan catabolism TAT lo tryptophan permease (characterized) 31% 65% 181.4 D-serine/D-alanine/glycine transporter 59% 570.9

Sequence Analysis Tools

View WP_012783773.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMGSGKAVSLAGPSILLIY
AITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFFTGWTYWLCWIVTAVAEVV
AVSGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEIEFWFALIKIITIIGLIITGI
YMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGFQISVFAFVGIELVGTAAAEAEN
PMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQVDPNSSPFVAMFSLAGIGIAAHFIN
FVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKAFSKLSNRKVPVHALIFSCIFLLSSVV
LLYAGQSMIQVFTLVTTISALLFIFIWSIILVSYLQYRRKHLERHEKSTFKMPGGRASVV
MVFIFFAFVLWALTQEPDTLAAMKVTPLWFVLLGIAYWVMKLKQKQS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory