Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate WP_004687208.1 BMI_RS13345 MHS family MFS transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >NCBI__GCF_000022745.1:WP_004687208.1 Length = 426 Score = 206 bits (523), Expect = 1e-57 Identities = 134/419 (31%), Positives = 218/419 (52%), Gaps = 12/419 (2%) Query: 22 ASRIKSIFSGS-VGNMVEWYDWYVYA-AFSLYFAKAFFPKGDTTAQLLNTAAIFAVGFLM 79 A+ ++ + + S +G +E++D+Y+YA A + F FFP D + LL + A FA+ F Sbjct: 11 ANSVRRVLTASMIGTTIEFFDFYIYATAAVIVFPHLFFPASDGNSALLQSFATFAIAFFA 70 Query: 80 RPIGGWLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPILLVFARLLQG 139 RP+G + G + D+ GRKA L+A++ M ++ I P Y +IGV AP+LL RL QG Sbjct: 71 RPVGAAIFGHFGDKIGRKATLVAALMTMGLSTVAIGFLPTYASIGVAAPLLLALCRLGQG 130 Query: 140 LSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQTLTTEQLYDW 199 L +GGE+G + +E A + +R ++ F + +G ++A G+ ++L +T+T EQ + + Sbjct: 131 LGLGGEWGGAVLLATENAPEGKRTWYGMFPQLGAPAGFILATGIFLLLAETMTEEQFFAY 190 Query: 200 GWRIPFAIGALCAIVALYLRRGMEETESFAKK-EKSKESAM--RTLLRHPKE--LMTVVG 254 GWR+PF A+ V L++R + ET F K +K++ A+ L RH K + +G Sbjct: 191 GWRVPFIASAILVAVGLFIRLRIAETPEFQKAIDKAERVAVPAAQLFRHHKMNLFLGTIG 250 Query: 255 LTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPIIGGLSDKVGRRP 314 TM + FY T + + +G S + + + F P+ LSD+ G R Sbjct: 251 -TMATFVLFYLMTVFSLGWGTRALGYSREEFLVLQMIGVIFFGLTIPLSALLSDRYGMRT 309 Query: 315 ILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAVVKAELFPTEIR 374 I++ +L L+ I+ L T FLI+ ++ Y I AV+ AE FPT +R Sbjct: 310 IMVIVTVLIGLYGF-IMAPLFAAGTAGVLGFLIIGFGLMGMTYGPIGAVL-AEPFPTSVR 367 Query: 375 ALGVGLPYALTVSIFGGTAEYIALWFKS-IGME-TGYYWYVTACIAVSLLVYVTMKDTR 431 G L + L + A YIA W + G GYY A I++ V++T+KD + Sbjct: 368 YTGASLAFNLAGILGASLAPYIATWLATDYGFAYVGYYMVAAAIISLIGFVFITLKDKK 426 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 426 Length adjustment: 32 Effective length of query: 407 Effective length of database: 394 Effective search space: 160358 Effective search space used: 160358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory