Align BadH (characterized)
to candidate WP_002965637.1 BMI_RS14780 SDR family oxidoreductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000022745.1:WP_002965637.1 Length = 252 Score = 145 bits (365), Expect = 1e-39 Identities = 102/253 (40%), Positives = 135/253 (53%), Gaps = 12/253 (4%) Query: 4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCD 63 L+ K A+ITG G G G +RFA+ GAK+ + D + AE+VAG I DA A AV D Sbjct: 3 LEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEIGDA---ALAVAAD 59 Query: 64 IADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTK--TEPGEWERLIAINLTGALHM 121 I+ VDAA+ + G VDILVNNAG KP EP E++R++ +N+ G M Sbjct: 60 ISKEADVDAAVEAALSKFGKVDILVNNAGIG-HKPQNAELVEPEEFDRIVGVNVRGVYLM 118 Query: 122 HHAVLPGMVER----RHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHG 177 ++P E + I+N+AS A A Y A KG +V+ +K LA E A Sbjct: 119 TRKLIPHFKENGAKGQECVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAK 178 Query: 178 ITVNVVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDA 237 I V + P +T LL T + E++ + F +IP+GRL KPDDLA A AF S A Sbjct: 179 IRVVALNPVAGETPLL--TTFMGEDSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQA 236 Query: 238 GFITGQVLSVSGG 250 ITG L V GG Sbjct: 237 SMITGVALDVDGG 249 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory