Align BadI (characterized)
to candidate WP_002965246.1 BMI_RS10105 enoyl-CoA hydratase
Query= metacyc::MONOMER-892 (260 letters) >NCBI__GCF_000022745.1:WP_002965246.1 Length = 257 Score = 112 bits (280), Expect = 8e-30 Identities = 81/263 (30%), Positives = 129/263 (49%), Gaps = 15/263 (5%) Query: 1 MQFEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDR 60 M +E +I E R+ V I +NRP +NA +EL AL D VGA+VL G+ ++ Sbjct: 1 MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGS-EK 59 Query: 61 AFCTGGD-QSTHDGNYDGRGTVGLPMEELHT---AIRDVPKPVIARVQGYAIGGGNVLAT 116 AF G D + N+ V ++++ + + KP+IA V GYA+GGG LA Sbjct: 60 AFAAGADIKEMQSINF-----VDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAM 114 Query: 117 ICDLTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMG 176 +CD I A FGQ +G + G+ L R VG+ KA ++ + EAE G Sbjct: 115 MCDFIIAGSNAKFGQPEITLGVIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCG 174 Query: 177 LANLCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYYD 236 L + V + L E K E + S ++ +AK + N A++ + + +L++ Sbjct: 175 LVSRVVAPEALLEEALKAAERIASFSRVSVYMAKEAVN--RAYETTLDEGLRFERRLFHS 232 Query: 237 ---TDESREGVKALQEKRKPEFR 256 T++ +EG+ A +KR P F+ Sbjct: 233 LFATEDQKEGMSAFVDKRTPSFK 255 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory