Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_004687607.1 BMI_RS15765 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_000022745.1:WP_004687607.1 Length = 244 Score = 151 bits (381), Expect = 2e-41 Identities = 97/262 (37%), Positives = 147/262 (56%), Gaps = 21/262 (8%) Query: 9 TPLLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRL 68 T LL V +LT RFGGL AVN+VSF+ N GEI IGPNGAGKTT+ I+G P+ G + Sbjct: 2 TALLEVRNLTKRFGGLTAVNNVSFTLNKGEILGFIGPNGAGKTTVVGLISGSIYPSSGEV 61 Query: 69 TLRHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFS 128 + A ++ +P YR + + RTFQ ++ F G+SVL+N+ + Sbjct: 62 YFKGA-----RIDTVPMYRRAH-MGIGRTFQIMKPFPGLSVLDNV--------------A 101 Query: 129 IAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPV 188 + + G A + A+ LD V L D A L ++RLE+A+A+ +P Sbjct: 102 VGAMFGRKEAHHGLTAAREQARANLDFVGLGNAIDKRAEELGGPDRKRLELAKALAMQPE 161 Query: 189 MLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKI 248 +L DE AGLN E E+ +++ +RD + +L+IEH M + ++SD ++VL +G KI Sbjct: 162 LLLCDEVMAGLNLVEIEEVIEVIRKVRDS-GVTILVIEHVMKAIKSLSDRLMVLHHGEKI 220 Query: 249 SDGDPAFVKNDPAVIRAYLGEE 270 ++G V ++P VI AYLG++ Sbjct: 221 AEGSTDAVLSNPVVIEAYLGKK 242 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 244 Length adjustment: 25 Effective length of query: 269 Effective length of database: 219 Effective search space: 58911 Effective search space used: 58911 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory