Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_004689230.1 BMI_RS08270 ATP-binding cassette domain-containing protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_000022745.1:WP_004689230.1 Length = 440 Score = 360 bits (925), Expect = e-104 Identities = 182/282 (64%), Positives = 223/282 (79%), Gaps = 2/282 (0%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 +L VEHL+MRFGGL+A+ND+SF G+ITAIIGPNGAGKTT+FNCITGFY PT G LT+ Sbjct: 10 ILQVEHLSMRFGGLIAINDLSFDVKRGDITAIIGPNGAGKTTVFNCITGFYKPTGGMLTM 69 Query: 71 RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIA 130 G+ FLLER+P ++I+++A VARTFQNIRLF G++VLENL+VAQHN L+R+SG++I Sbjct: 70 HRKTGENFLLERLPDFQITKQAKVARTFQNIRLFSGLTVLENLLVAQHNTLMRSSGYTIL 129 Query: 131 GLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVML 190 GLLGLP Y +EA++ A++WL+++ L+ AD AG+LPYG QRRLEIARAMCT+P +L Sbjct: 130 GLLGLPGYKTAAKEAIEKARFWLEKINLIARADDPAGDLPYGDQRRLEIARAMCTDPEIL 189 Query: 191 CLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKISD 250 CLDEPAAGLNPRES EL LL IR E +LLIEHDMSVVM ISDHV+VL+YG KISD Sbjct: 190 CLDEPAAGLNPRESAELNTLLLDIRKETGTSILLIEHDMSVVMEISDHVIVLEYGTKISD 249 Query: 251 GDPAFVKNDPAVIRAYLGEEEDEELPPEIK-ADLPEVAKRAE 291 G P VKNDP VI AYLG +DEE+ I+ AD P V A+ Sbjct: 250 GAPEEVKNDPRVIAAYLG-VDDEEIADLIEGADKPGVEDPAD 290 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 440 Length adjustment: 29 Effective length of query: 265 Effective length of database: 411 Effective search space: 108915 Effective search space used: 108915 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory