Align phosphotransacetylase (EC 2.3.1.8) (characterized)
to candidate WP_008506596.1 BMI_RS00680 NADP-dependent malic enzyme
Query= metacyc::PTACLOS-MONOMER (333 letters) >NCBI__GCF_000022745.1:WP_008506596.1 Length = 764 Score = 155 bits (393), Expect = 2e-42 Identities = 105/330 (31%), Positives = 168/330 (50%), Gaps = 14/330 (4%) Query: 4 IESIWECAKQDKKRIILAEGEEKRNLIAADKIIKEGLAELVLVGDENKIKEKASELNLDI 63 + I+E ++ KRI+ AEGEE++ + AA + +GL +LVG E ++E A LD+ Sbjct: 443 LRGIYERVRRQPKRIVFAEGEEEQVMRAAVSYVNQGLGTAILVGREEHVEETARAAGLDL 502 Query: 64 SKA--EIMDPETSLKTETYARDFYELRKHKGMTIEKSEKMVR-DPLYFATMALKDGYVDG 120 ++ E+++ S + YA YE + +G +++ D +FA + G DG Sbjct: 503 NRPGIEVINARLSSRNAAYADYLYEKLQRRGYLARDCLRLINNDRNHFAACMVALGDADG 562 Query: 121 MVSGAVHTTGDLLRPGLQIIKTAPGVKIVSGFFVMIIPDCDYGEEGLLLF-ADCAVNPNP 179 MV+G L ++I + PG ++V + G +F AD AV+ P Sbjct: 563 MVTGVTRNYATGLDDVRRVIDSKPGHRMVGVSIALC--------RGRTVFIADTAVHEMP 614 Query: 180 TSDELADIAITTAETARKLCNVEPKVAMLSFSTMGSAKGEMVDKVKNAVEITKKFRPDLA 239 T+ ELADIA+ A AR++ V P+VA+ +FST G GE +++ AV I D Sbjct: 615 TAAELADIAVEAAGMARRMGYV-PRVALTAFSTFGHMGGERSARIQEAVRILATRHVDFE 673 Query: 240 IDGELQLDAAIDSEVAALKAPSSNVAGNANVLVFPDLQTGNIGYKLVQRFAKAKAIGPIC 299 DGE+ D A++ ++ + P ++G ANV+V PD + +I ++Q A IGP+ Sbjct: 674 FDGEMSADVALNPKLME-QYPFIRLSGPANVIVTPDNHSASIAADMLQELGGATIIGPLL 732 Query: 300 QGFAKPINDLSRGCSSEDIVNVVAITVVQA 329 G KP ++ G DIVN+ AIT A Sbjct: 733 VGLDKPAQIVTIGAKDSDIVNMAAITAYNA 762 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 534 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 764 Length adjustment: 34 Effective length of query: 299 Effective length of database: 730 Effective search space: 218270 Effective search space used: 218270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory