Align citrate lyase β subunit (EC 4.1.3.34) (characterized)
to candidate WP_002966416.1 BMI_RS10875 CoA ester lyase
Query= metacyc::MONOMER-16999 (289 letters) >NCBI__GCF_000022745.1:WP_002966416.1 Length = 274 Score = 118 bits (296), Expect = 1e-31 Identities = 92/277 (33%), Positives = 140/277 (50%), Gaps = 27/277 (9%) Query: 5 RSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVYQALQHPLYQDIETV 64 R+ LF+P S + G D V+ DLEDAV+ + KD AR A + D+ + Sbjct: 8 RAPLFVPADRPDRFSKAAASGTDCVILDLEDAVAPKAKDAAR-----AALDTSFTDLPVM 62 Query: 65 VRINPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGREVGSTKL 124 VRINP TP+ AD+ AV R V V LPK ++ E I E + L Sbjct: 63 VRINPHGTPWHEADMAAVARLDVAGVILPKAETAERI------------EAAARMLDLPL 110 Query: 125 MAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDMGTSRGDGTELFYARCAVLHAARV 184 +A +E+A G+ NA IA AS + +A + D+ D+ + L AR ++ A+R+ Sbjct: 111 IALVETARGLANARSIAAAS-GVVRLAFGSIDFCADLACAHMREI-LLPARVELVMASRL 168 Query: 185 AGIAA-YDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEVDHA 243 AGIAA D V N+ +A A+ LG GK ++PRQI + + +A + +E+D A Sbjct: 169 AGIAAPIDGVTPGFNDPVMCHQDAAHARALGMMGKLCIHPRQISEVLRAFAWSDQEIDWA 228 Query: 244 LEVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVV 280 V+A+ E G +S++G M+D P+ AR ++ Sbjct: 229 RRVLASGE-------GAISIDGMMVDEPVRIRARTIL 258 Lambda K H 0.319 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 274 Length adjustment: 26 Effective length of query: 263 Effective length of database: 248 Effective search space: 65224 Effective search space used: 65224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory