Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_002966213.1 BMI_RS11900 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000022745.1:WP_002966213.1 Length = 609 Score = 181 bits (460), Expect = 2e-50 Identities = 106/255 (41%), Positives = 150/255 (58%), Gaps = 21/255 (8%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 +L V+ L KHFGGL +V+ L EGE++GLIGPNGAGKTTLFN+++G P EGTV L Sbjct: 366 ILRVQNLNKHFGGLHVTRNVSFTLREGEVLGLIGPNGAGKTTLFNMISGFLAPDEGTVNL 425 Query: 63 ---DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLI-AFGNHHKQHVFTSFLRL 118 DG K+P A+LGLGRTFQ ++ F +TV +N+++ AF HH Sbjct: 426 CGADGQFHAPKNPADFAALGLGRTFQIVQPFAAMTVEENIMVGAFYRHH----------- 474 Query: 119 PAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEP 178 EK+ + A E L A+ L+ G +RLE+ R +A EP+IL LDE Sbjct: 475 -----HEKDAREAARETAWRMGLGPLLGAEARGLTIGGLKRLEVARVMAMEPRILLLDEV 529 Query: 179 AAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDE 238 AG+N + +L+ I+D ++I+ IEH M VM +++R+ VL G +IAQG P + Sbjct: 530 MAGINQTDVRRAIDLMLSIRDS-GVSIIAIEHVMQAVMSLSDRVIVLASGEVIAQGRPQD 588 Query: 239 IKTNKRVIEAYLGGE 253 + + +V+EAYLG E Sbjct: 589 VVRDPQVVEAYLGKE 603 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 609 Length adjustment: 31 Effective length of query: 223 Effective length of database: 578 Effective search space: 128894 Effective search space used: 128894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory