Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_004687607.1 BMI_RS15765 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000022745.1:WP_004687607.1 Length = 244 Score = 181 bits (458), Expect = 2e-50 Identities = 103/252 (40%), Positives = 152/252 (60%), Gaps = 16/252 (6%) Query: 2 ALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVT 61 ALLEV+ LTK FGGLTAV +V+ LN+GE++G IGPNGAGKTT+ L++G PS G V Sbjct: 3 ALLEVRNLTKRFGGLTAVNNVSFTLNKGEILGFIGPNGAGKTTVVGLISGSIYPSSGEVY 62 Query: 62 LDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIA--FGNHHKQHVFTSFLRLP 119 G ++ Y+ A +G+GRTFQ ++ F L+VLDNV + FG H T+ Sbjct: 63 FKGARIDTVPMYRRAHMGIGRTFQIMKPFPGLSVLDNVAVGAMFGRKEAHHGLTA----- 117 Query: 120 AFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPA 179 + +A L L + A+ L ++RLE+ +ALA +P++L DE Sbjct: 118 --------AREQARANLDFVGLGNAIDKRAEELGGPDRKRLELAKALAMQPELLLCDEVM 169 Query: 180 AGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEI 239 AG+N E E+ E+IR+++D +TI++IEH M + +++R+ VL +G IA+G+ D + Sbjct: 170 AGLNLVEIEEVIEVIRKVRDS-GVTILVIEHVMKAIKSLSDRLMVLHHGEKIAEGSTDAV 228 Query: 240 KTNKRVIEAYLG 251 +N VIEAYLG Sbjct: 229 LSNPVVIEAYLG 240 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 244 Length adjustment: 24 Effective length of query: 230 Effective length of database: 220 Effective search space: 50600 Effective search space used: 50600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory