Align Aromatic amino acid transporter AroP (characterized, see rationale)
to candidate WP_012783773.1 BMI_RS10370 amino acid permease
Query= uniprot:A0A2Z5MFR8 (461 letters) >NCBI__GCF_000022745.1:WP_012783773.1 Length = 467 Score = 345 bits (885), Expect = 2e-99 Identities = 176/443 (39%), Positives = 271/443 (61%), Gaps = 5/443 (1%) Query: 6 QQDGLKRGLKNRHIQLIALGGAIGTGLFLGSASVLQAAGPSMILGYAIGGVIAFMIMRQL 65 ++ L R L NRH+QLIA+GG IGTGLF+GS + AGPS++L YAI G + F +MR L Sbjct: 15 EEPHLARNLSNRHLQLIAIGGTIGTGLFMGSGKAVSLAGPSILLIYAITGFMLFFVMRAL 74 Query: 66 GEMVAQEPVAGSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGTYVHYWWPGVP 125 GE++ SF+ FA Y G F +GW YW+ +++ ++AE+ AV YV +W+P + Sbjct: 75 GEILLSNLQYRSFADFAGDYLGPCAQFFTGWTYWLCWIVTAVAEVVAVSGYVSFWFPHLA 134 Query: 126 TWVSALVCFAGINAINLANVKAYGETEFWFAIIKVVAVIGMILFGGYLLVSGH---GGPQ 182 W+ AL + +NL V+ +GE EFWFA+IK++ +IG+I+ G Y+L++G G Q Sbjct: 135 PWIPALGLITILLILNLPTVRNFGEIEFWFALIKIITIIGLIITGIYMLMTGFVLPNGTQ 194 Query: 183 ASISNLWSHGGFFPHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKSIPKAVNQVIY 242 ASI++LW+HGGFFP+G G + +F+F G+EL+G AAEA+ P +++PKA+N + Sbjct: 195 ASIAHLWNHGGFFPNGSLGFIAGFQISVFAFVGIELVGTAAAEAENPMRNLPKAINNIPI 254 Query: 243 RILIFYICSLAVLLSLYPWNEVAAGGSPFVMIFSQIGSTLTANVLNVVVLTAALSVYNSG 302 RI++FYI +L V++++ PWN+V SPFV +FS G + A+ +N VVLT+A S NSG Sbjct: 255 RIVLFYIGALFVIITVTPWNQVDPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSNSG 314 Query: 303 VYANSRMLYGLAEQGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYLIPAEALGLLM 362 +Y+ SRM+YGLA G AP+A K+ R VP A+ S + + V++ Y + + Sbjct: 315 IYSTSRMVYGLATVGLAPKAFSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTL 374 Query: 363 ALVVAAL--VLNWALISLTHLKSRRAMVAAGETLVFKSFWFPVSNWICLAFMALILVILA 420 ++AL + W++I +++L+ RR + E FK S + F A +L L Sbjct: 375 VTTISALLFIFIWSIILVSYLQYRRKHLERHEKSTFKMPGGRASVVMVFIFFAFVLWALT 434 Query: 421 MTPGLSVSVLLVPLWLVVMWAGY 443 P ++ + PLW V++ Y Sbjct: 435 QEPDTLAAMKVTPLWFVLLGIAY 457 Lambda K H 0.327 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 467 Length adjustment: 33 Effective length of query: 428 Effective length of database: 434 Effective search space: 185752 Effective search space used: 185752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory