Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_015799815.1 BMI_RS11110 acyl-CoA dehydrogenase
Query= BRENDA::Q92947 (438 letters) >NCBI__GCF_000022745.1:WP_015799815.1 Length = 384 Score = 172 bits (435), Expect = 2e-47 Identities = 131/388 (33%), Positives = 185/388 (47%), Gaps = 26/388 (6%) Query: 51 QDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTI 110 +DP LE ++RDT + E L+PR +II++M ELG G TI Sbjct: 3 RDPETLE--------ILRDTVSQFVSETLIPRENEVAETNAIPADIIAQMKELGFFGLTI 54 Query: 111 -KGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLA 169 + +G G++ +A EL R +RS + + + I G++EQ++ YLP+LA Sbjct: 55 PEEFGGLGLTMEEEVNVAFELGRASPAFRSYIGTNNGIGSIGILIDGTDEQKRNYLPRLA 114 Query: 170 KGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARC- 228 GELL F LTEP++GSD +S++T A + Y LNGTK +ITN+P+AD+F V AR Sbjct: 115 SGELLSSFCLTEPDAGSDAASLKTTAVRDGD--FYILNGTKRFITNAPIADIFTVMARTA 172 Query: 229 -----EDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSL 283 DG I F++E+ GLS + K + + T +I + V VP ++ G Sbjct: 173 ADVKGADG-ISAFIVERNSPGLSLGKPDQKMGQKGALTSDVIFENVRVPASQLIGGVEGK 231 Query: 284 G--GPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLT 341 G L+ R IA GA+E L YALDR QFG P+A QLIQ LAD Sbjct: 232 GFKTAMKVLDKGRLHIAALSTGAAERMLADTLAYALDRKQFGKPIADFQLIQAMLADSKA 291 Query: 342 EITLGLHACLQLGRLKDQDKAAPEMVSLLK---RNNCGKALDIARQARDMLGGNGISDEY 398 EI L R +D + S K CG+ D Q GG G EY Sbjct: 292 EIYAAKCMVLDAARKRDSGQNVSTEASCAKMFATEMCGRVADRCVQIH---GGAGYVSEY 348 Query: 399 HVIRHAMNLEAVNTYEGTHDIHALILGR 426 + R ++ EGT I +++ R Sbjct: 349 AIERFYRDVRLFRICEGTTQIQQIVIAR 376 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 384 Length adjustment: 31 Effective length of query: 407 Effective length of database: 353 Effective search space: 143671 Effective search space used: 143671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory