Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_002968290.1 BMI_RS11120 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_000022745.1:WP_002968290.1 Length = 261 Score = 116 bits (290), Expect = 5e-31 Identities = 79/260 (30%), Positives = 128/260 (49%), Gaps = 5/260 (1%) Query: 2 SAELLTSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADN 61 S + S ++ + ++ P ARNAL+ E ++ D S+RA+V+TG + Sbjct: 4 SEDRFVSVERHADGVATVRINRPEARNALNLTTRQQLAEHFRALSGDESVRAIVLTGGET 63 Query: 62 FFCAGGNLNRLLENRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLAL 121 F AG ++ A + + + L W A+ +KPVIAAV+G A G G LA+ Sbjct: 64 CFVAGADVREFAS--AGPIEMYLRHTEYL--W-DAIASCAKPVIAAVNGYALGGGCELAM 118 Query: 122 ACDLIVAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELG 181 CD+IVA + A F ++GL P GG+ L +A+ + A + + G + AA +G Sbjct: 119 HCDIIVAGEGAVFGQPEVKLGLMPGAGGTQRLIRAVGKFQAMRIALTGCMVPAAEALSIG 178 Query: 182 VVNKLTKPGTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASL 241 +++++T A A E+ ++ +VA+IK ++ PL L ER F Sbjct: 179 MISEMTANERTLPRAHELAVEIARLPALAVAQIKEVMLVGADLPLDGALALERKAFQLLF 238 Query: 242 HHREGLEGISAFLEKRAPVY 261 ++ EG +AFLEKR P Y Sbjct: 239 DSKDQKEGAAAFLEKRKPAY 258 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 261 Length adjustment: 25 Effective length of query: 237 Effective length of database: 236 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory