Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_006161151.1 BMI_RS06145 acyl-CoA dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_000022745.1:WP_006161151.1 Length = 385 Score = 221 bits (562), Expect = 3e-62 Identities = 137/375 (36%), Positives = 195/375 (52%), Gaps = 2/375 (0%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKSLFPEYARDLFAKLGLLNPLLPAAYGGTEM 63 L E+Q +M + A IAP+AL+ D FP LG+ + GG+ + Sbjct: 11 LNEDQCAIQEMAQAFAADRIAPQALQWDRDKHFPVDILRETGPLGMGGIYVRDDVGGSGL 70 Query: 64 GVLTLALILEELGRVCASTALLLIAQTDGMLPIIHGGSPELKERYLRRFAGESTLLTALA 123 L LI E L C + + L I G+ E ++R+L + L + Sbjct: 71 KRLDAVLIFEALATACPTFSAFLSIHNMAAWMIDTFGNEEQRQRFLPQLTSMEWL-ASYC 129 Query: 124 ATEPAAGSDLLAMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPEKGSKGISAF 183 TEP +GSD A+KTRAVR GD Y++NG K FI+ D+ V T E G KGIS Sbjct: 130 LTEPGSGSDAAALKTRAVRDGDHYIVNGAKQFISGAGSTDLYVTMVRTG-EDGPKGISTL 188 Query: 184 VVEKGTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAEGTGFANLMQTLSTNRV 243 VV K PGL +G NE KMG + F+N VP EN +G EG GF M L R+ Sbjct: 189 VVPKDAPGLSFGANEYKMGWNAQPTRTVIFDNCRVPVENRLGDEGVGFKIAMAGLDGGRL 248 Query: 244 FCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEASRLLTRKAAE 303 AA ++G AQ A A+ + +R FG+ I +QF +ADM T + ASR+L AA Sbjct: 249 NIAACSLGGAQAATAKALEYCAERKAFGQTIDRFQALQFRLADMETELAASRMLLYTAAS 308 Query: 304 LLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMRDAKLTQIYT 363 LD A + +MAK +DT+ V +A+Q+LGG GY+ + G+E+++RD ++ QI Sbjct: 309 KLDRKTHDAGKWSAMAKRFVTDTSFNVANEALQLLGGYGYLHDYGIEKLVRDLRVHQILE 368 Query: 364 GTNQITRMVTGRALL 378 GTN+I R++ R ++ Sbjct: 369 GTNEIMRVIIARHMI 383 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 385 Length adjustment: 30 Effective length of query: 350 Effective length of database: 355 Effective search space: 124250 Effective search space used: 124250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory