Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate WP_015799638.1 BMI_RS05285 pyruvate dehydrogenase complex E1 component subunit beta
Query= uniprot:G1UHX5 (328 letters) >NCBI__GCF_000022745.1:WP_015799638.1 Length = 461 Score = 223 bits (567), Expect = 9e-63 Identities = 126/327 (38%), Positives = 184/327 (56%), Gaps = 2/327 (0%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE 60 M +T+ +AL A+ + +R DP + GE++ G ++IT GL EFG +R DTP+ E Sbjct: 135 MVSMTVREALRDAMAEEMRRDPDVFIMGEEVAQYQGAYKITQGLLDEFGPKRVVDTPITE 194 Query: 61 SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG 120 G VG A G +P+VE FA A +Q+V+ AK + G +G P+ R P G Sbjct: 195 HGFAGVGVGAAFAGLKPIVEFMTFNFAMQAIDQIVNSAAKTLYVSGGQMGAPMVFRGPSG 254 Query: 121 GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRK 180 HS +Y PGL VV P TAADA LL+ +I P+PV+FLE + LY Sbjct: 255 AAARVAAQHSQCYAAWYSHIPGLKVVMPYTAADAKGLLKAAIRDPNPVIFLENEILYGHH 314 Query: 181 -EALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLM 239 + L P+G A I + G AT++++G +T A++AAE A G D+E+IDLRT+ Sbjct: 315 FDVPKLDDFVLPIGKARIHKQGKDATIVSFGIGMTYAVKAAEELAGQGIDVEIIDLRTIR 374 Query: 240 PLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP 299 P+D TV SV++TGR V V E + G EIA R+ ++ F +L+AP+ + G DVP P Sbjct: 375 PMDIPTVVESVKKTGRLVTVEEGFPQSSVGTEIATRVMQQAFDYLDAPILTIAGKDVPMP 434 Query: 300 -PPLLERHYLPGVDRILDAVASLEWEA 325 LE+ LP V +++AV ++ + A Sbjct: 435 YAANLEKLALPSVAEVVEAVKAVTYTA 461 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 461 Length adjustment: 30 Effective length of query: 298 Effective length of database: 431 Effective search space: 128438 Effective search space used: 128438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory