Align BadK (characterized)
to candidate WP_002965570.1 BMI_RS15215 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000022745.1:WP_002965570.1 Length = 282 Score = 189 bits (480), Expect = 5e-53 Identities = 110/253 (43%), Positives = 145/253 (57%), Gaps = 1/253 (0%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGA 65 I T V ++ LNRPD LNA+N + L + + D I IVIAG FAAG+ Sbjct: 31 IETRPADGVALLELNRPDALNAVNMDVRQKLAASADSLVEDPDIRVIVIAGRGGNFAAGS 90 Query: 66 DIASMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRS 125 D+ A + + R WE++ KPV+AAV G A GGGCELA+ DI++A R+ Sbjct: 91 DVKVFAQTGAGSLLAQR-MHRYWESLAHCPKPVIAAVEGYALGGGCELAMHADIIVAART 149 Query: 126 AKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDR 185 A F PEIKLGL+PGAGGTQRL RAIGK K M + L+ L A EA++YGLVSR+ ++ Sbjct: 150 ASFGQPEIKLGLMPGAGGTQRLLRAIGKYKTMLLALTGEMLPATEAEKYGLVSRLSEEGE 209 Query: 186 LRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQ 245 +E + LA IA A A +KE++ ++ L + ER+ F + D REGI Sbjct: 210 ALEEALKLARKIALMPALAAEQIKEAVMYGEDAPLETALRLERKAFQLLFDTEDKREGID 269 Query: 246 AFLEKRAPCFSHR 258 AFL KR P F R Sbjct: 270 AFLTKRKPAFKGR 282 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 282 Length adjustment: 25 Effective length of query: 233 Effective length of database: 257 Effective search space: 59881 Effective search space used: 59881 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory