Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_002965570.1 BMI_RS15215 enoyl-CoA hydratase
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000022745.1:WP_002965570.1 Length = 282 Score = 222 bits (566), Expect = 6e-63 Identities = 118/248 (47%), Positives = 156/248 (62%) Query: 10 PEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKAFAAGADIKE 69 P GV L+ L RP+ALNA+N + +LAA +D + R +V+ G FAAG+D+K Sbjct: 35 PADGVALLELNRPDALNAVNMDVRQKLAASADSLVEDPDIRVIVIAGRGGNFAAGSDVKV 94 Query: 70 MAERDLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIAGEDARFGQ 129 A+ +L +W+ +A KP+IAAV G+ LGGGCELAMHADI++A A FGQ Sbjct: 95 FAQTGAGSLLAQRMHRYWESLAHCPKPVIAAVEGYALGGGCELAMHADIIVAARTASFGQ 154 Query: 130 PEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTLPELTIERA 189 PEI LG+MPGAGGTQRLLRA+GK M + L+G+ + A A++ GLVS ++ +E A Sbjct: 155 PEIKLGLMPGAGGTQRLLRAIGKYKTMLLALTGEMLPATEAEKYGLVSRLSEEGEALEEA 214 Query: 190 LAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAEGIRAFQEK 249 L +AR IA LA KEA++ ED L + LR ER AF +L T D+ EGI AF K Sbjct: 215 LKLARKIALMPALAAEQIKEAVMYGEDAPLETALRLERKAFQLLFDTEDKREGIDAFLTK 274 Query: 250 RRPEFTGR 257 R+P F GR Sbjct: 275 RKPAFKGR 282 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 282 Length adjustment: 25 Effective length of query: 232 Effective length of database: 257 Effective search space: 59624 Effective search space used: 59624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory