Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_004689226.1 BMI_RS08205 acetyl-CoA C-acetyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_000022745.1:WP_004689226.1 Length = 394 Score = 322 bits (826), Expect = 9e-93 Identities = 188/396 (47%), Positives = 251/396 (63%), Gaps = 10/396 (2%) Query: 5 LIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQAGEDN 64 +I A RT +G + GA A+V A +LGA+ +KA + R +D + VD+VI G AGE Sbjct: 8 VIASAARTAVGAFNGAFANVPAHELGAVAIKAALER-AGVDAADVDEVILGQVLTAGE-G 65 Query: 65 RNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSRAP 124 +N AR AA+ AG P +N+LCGSGL AV + + G+A +++AGG ESMS AP Sbjct: 66 QNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAP 125 Query: 125 FVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRADQDAF 184 ++ DT + + GI TAEN+A Q+ +SR++QD F Sbjct: 126 HCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGI-----TAENIARQWQLSRSEQDEF 180 Query: 185 ALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGTPFRQ 244 AL SQHKA AA GR +EIV + RKG +V DE+ R TT+E LAKL F + Sbjct: 181 ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDV-VVSADEYIRPGTTMEVLAKLKPAFDK 239 Query: 245 GGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGPVPATR 304 G+VTAGNASG+NDGA A++L + A R G+K AR+V ATAGV+P IMG GP+PATR Sbjct: 240 EGTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATR 299 Query: 305 KVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPLGMSGA 364 K LE G ++ D+D++E NEAFAAQ AV+R+LGL + E VN NGGAIA+GHP+G SGA Sbjct: 300 KALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGL--NPEIVNVNGGAIAIGHPIGASGA 357 Query: 365 RLVTTALHELEERQGRYALCTMCIGVGQGIALIIER 400 R++TT L+E+E R + L T+CIG G G+AL +ER Sbjct: 358 RVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVER 393 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 394 Length adjustment: 31 Effective length of query: 370 Effective length of database: 363 Effective search space: 134310 Effective search space used: 134310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory