Align Proline-specific permease (ProY) (characterized)
to candidate WP_012783773.1 BMI_RS10370 amino acid permease
Query= TCDB::P37460 (456 letters) >NCBI__GCF_000022745.1:WP_012783773.1 Length = 467 Score = 362 bits (930), Expect = e-104 Identities = 187/453 (41%), Positives = 285/453 (62%), Gaps = 7/453 (1%) Query: 2 ESNNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMRA 61 E L R LS RH++ +A+G IGTGLF GS A+ +AGPS+LL Y I G + +MRA Sbjct: 14 EEEPHLARNLSNRHLQLIAIGGTIGTGLFMGSGKAVSLAGPSILLIYAITGFMLFFVMRA 73 Query: 62 LGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPAV 121 LGE+ + N SF+ +A + LGP A + TGWTY ++ A+A+V A Y+ WFP + Sbjct: 74 LGEILLSNLQYRSFADFAGDYLGPCAQFFTGWTYWLCWIVTAVAEVVAVSGYVSFWFPHL 133 Query: 122 PHWIWVLSVVLIICAINLMSVKVFGELEFWFSFFKVATIIIMIVAGIGIIVWG--IGNGG 179 WI L ++ I+ +NL +V+ FGE+EFWF+ K+ TII +I+ GI +++ G + NG Sbjct: 134 APWIPALGLITILLILNLPTVRNFGEIEFWFALIKIITIIGLIITGIYMLMTGFVLPNGT 193 Query: 180 QPTGIHNLWSNGGFFSNGWLGMIMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSV 239 Q + H LW++GGFF NG LG I Q+ +FA+ GIE++G A EA++P +++P+AIN++ Sbjct: 194 QASIAH-LWNHGGFFPNGSLGFIAGFQISVFAFVGIELVGTAAAEAENPMRNLPKAINNI 252 Query: 240 PMRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGITFAASILNFVVLTASLSAIN 299 P+RI++FY+G LFVI+++ PWNQV N SPFV F GI AA +NFVVLT++ S+ N Sbjct: 253 PIRIVLFYIGALFVIITVTPWNQVDPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSN 312 Query: 300 SDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVTVLVMTIALLFAVYLNYIMPE--NVF 357 S ++ RM++G+A G APK F+K S R +P ++ I LL +V L Y VF Sbjct: 313 SGIYSTSRMVYGLATVGLAPKAFSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVF 372 Query: 358 LVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVPGGVVTTIAGLIFLVFIIA 417 ++ +++ +++W +IL+S + +RR+ K+ FK+PGG + + IF F++ Sbjct: 373 TLVTTISALLFIFIWSIILVSYLQYRRKHLERHEKS-TFKMPGGRASVVMVFIFFAFVLW 431 Query: 418 LIGYHPDTRISLYVGFAWIVLLLIG-WIFKRRR 449 + PDT ++ V W VLL I W+ K ++ Sbjct: 432 ALTQEPDTLAAMKVTPLWFVLLGIAYWVMKLKQ 464 Lambda K H 0.329 0.143 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 631 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 467 Length adjustment: 33 Effective length of query: 423 Effective length of database: 434 Effective search space: 183582 Effective search space used: 183582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory