Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_002965694.1 BMI_RS14505 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000022745.1:WP_002965694.1 Length = 271 Score = 165 bits (417), Expect = 1e-45 Identities = 97/256 (37%), Positives = 148/256 (57%), Gaps = 6/256 (2%) Query: 2 TEKSNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTP 61 ++ ++ +VL G+ K FGG A+ +V + ++ +V+ LIGPNGAGKTT FN++T P Sbjct: 19 SQTASGIVLSARGLGKSFGGFHAVKNVDLDVEHARVHALIGPNGAGKTTVFNLLTKFLQP 78 Query: 62 DAGTFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAV 121 +G L G+ T VA+ G+ R+FQ F +T LENV V ++ +GL Sbjct: 79 TSGEITLLGETITKTDPARVARKGLVRSFQISATFPHLTVLENVKVA--LQRPNGLATQF 136 Query: 122 FRTKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIAL 181 +R+ + + +A ELL+ VG+ A LSYG +R LEIA LA DP+++ L Sbjct: 137 WRS---LSALDRLDAQAVELLERVGLADARHALAADLSYGRKRALEIATTLALDPKVLLL 193 Query: 182 DEPAAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNP 241 DEP AGM + + LI + D R +L++EH++K+V + VTVL G+ +A G+ Sbjct: 194 DEPLAGMGHEDVHTIAALITDVAKD-RAVLMVEHNLKVVADIAHHVTVLQRGEILASGDY 252 Query: 242 AEVQKNEKVIEAYLGT 257 A V K+E+V AY+GT Sbjct: 253 ATVSKDERVRTAYMGT 268 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 271 Length adjustment: 25 Effective length of query: 235 Effective length of database: 246 Effective search space: 57810 Effective search space used: 57810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory