Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_002966213.1 BMI_RS11900 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000022745.1:WP_002966213.1 Length = 609 Score = 175 bits (444), Expect = 2e-48 Identities = 100/251 (39%), Positives = 146/251 (58%), Gaps = 18/251 (7%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L+V ++K FGGL +V T++ G+V GLIGPNGAGKTT FN+I+G PD GT L Sbjct: 366 ILRVQNLNKHFGGLHVTRNVSFTLREGEVLGLIGPNGAGKTTLFNMISGFLAPDEGTVNL 425 Query: 69 AGKP---YEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTK 125 G + P + A G+ RTFQ ++ FA MT EN+MVG R Sbjct: 426 CGADGQFHAPKNPADFAALGLGRTFQIVQPFAAMTVEENIMVGAFYR------------- 472 Query: 126 GFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPA 185 E + A+E +G+G +AR L+ G +RLE+AR +A +P+++ LDE Sbjct: 473 --HHHEKDAREAARETAWRMGLGPLLGAEARGLTIGGLKRLEVARVMAMEPRILLLDEVM 530 Query: 186 AGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQ 245 AG+N T+ + +L+ IR+ +I+ IEH ++ VM L DRV VL G+ IA+G P +V Sbjct: 531 AGINQTDVRRAIDLMLSIRDSGVSIIAIEHVMQAVMSLSDRVIVLASGEVIAQGRPQDVV 590 Query: 246 KNEKVIEAYLG 256 ++ +V+EAYLG Sbjct: 591 RDPQVVEAYLG 601 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 609 Length adjustment: 31 Effective length of query: 229 Effective length of database: 578 Effective search space: 132362 Effective search space used: 132362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory