Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_004689230.1 BMI_RS08270 ATP-binding cassette domain-containing protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000022745.1:WP_004689230.1 Length = 440 Score = 163 bits (413), Expect = 5e-45 Identities = 95/259 (36%), Positives = 151/259 (58%), Gaps = 11/259 (4%) Query: 11 LLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIF 70 +L L FGG+ A+ + +V +G IT +IGPNGAGKTT+FN ++ F +P G + Sbjct: 10 ILQVEHLSMRFGGLIAINDLSFDVKRGDITAIIGPNGAGKTTVFNCITGFYKPTGGMLTM 69 Query: 71 DGEP-----IQQLQPHQIAQQGMV-RTFQVARTLSRLSVLENMLLAAQ----KQTGENFW 120 + +++L QI +Q V RTFQ R S L+VLEN+L+A + +G Sbjct: 70 HRKTGENFLLERLPDFQITKQAKVARTFQNIRLFSGLTVLENLLVAQHNTLMRSSGYTIL 129 Query: 121 QVQLQPQVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKL 180 + P ++ + E+A F LE + L +A + AG L G ++ LE+ RA+ T+P++ Sbjct: 130 GLLGLPGYKTAAKEAI-EKARFWLEKINLIARADDPAGDLPYGDQRRLEIARAMCTDPEI 188 Query: 181 ILLDEPAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLA 240 + LDEPAAG+NPR ++ +L ++ G + L+IEH+M V+M + D V VL G ++ Sbjct: 189 LCLDEPAAGLNPRESAELNTLLLDIRKETGTSILLIEHDMSVVMEISDHVIVLEYGTKIS 248 Query: 241 DGTPAEIQTNSQVLEAYLG 259 DG P E++ + +V+ AYLG Sbjct: 249 DGAPEEVKNDPRVIAAYLG 267 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 440 Length adjustment: 28 Effective length of query: 232 Effective length of database: 412 Effective search space: 95584 Effective search space used: 95584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory