GapMind for catabolism of small carbon sources

 

Protein WP_012036625.1 in Methanocella arvoryzae MRE50

Annotation: NCBI__GCF_000063445.1:WP_012036625.1

Length: 256 amino acids

Source: GCF_000063445.1 in NCBI

Candidate for 52 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2560 hi ABC transporter for L-Histidine, ATPase component (characterized) 48% 95% 244.6 Bicarbonate transport ATP-binding protein CmpC; EC 7.6.2.- 44% 218.4
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 38% 58% 167.2 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 43% 54% 167.2 ABC transporter for L-Histidine, ATPase component 48% 244.6
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 38% 58% 167.2 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 60% 164.5 ABC transporter for L-Histidine, ATPase component 48% 244.6
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 60% 164.5 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 57% 162.5 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 39% 64% 161.8 ABC transporter for L-Histidine, ATPase component 48% 244.6
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 36% 64% 161.4 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 36% 57% 160.2 ABC transporter for L-Histidine, ATPase component 48% 244.6
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 39% 60% 157.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 69% 157.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 39% 58% 156.8 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 39% 57% 156.4 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 55% 156 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 39% 56% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 39% 55% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 39% 56% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 39% 56% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 39% 56% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 35% 61% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 39% 56% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 39% 56% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 55% 153.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 80% 152.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 80% 152.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 61% 151 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 61% 151 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 60% 150.6 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism thuK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 60% 150.6 ABC transporter for L-Histidine, ATPase component 48% 244.6
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 60% 150.6 ABC transporter for L-Histidine, ATPase component 48% 244.6
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 37% 56% 150.6 ABC transporter for L-Histidine, ATPase component 48% 244.6
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 60% 150.6 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 36% 62% 150.2 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 37% 64% 149.4 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 37% 58% 149.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 58% 147.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 58% 147.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 58% 147.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 58% 147.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 58% 147.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 58% 147.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 35% 60% 146.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 144.1 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 33% 60% 143.7 ABC transporter for L-Histidine, ATPase component 48% 244.6
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 68% 137.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 68% 137.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 68% 137.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 68% 137.9 ABC transporter for L-Histidine, ATPase component 48% 244.6
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 34% 67% 137.5 ABC transporter for L-Histidine, ATPase component 48% 244.6
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 36% 72% 120.2 ABC transporter for L-Histidine, ATPase component 48% 244.6
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 32% 59% 102.1 ABC transporter for L-Histidine, ATPase component 48% 244.6

Sequence Analysis Tools

View WP_012036625.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAGDIKIQGVSKEYPAKGGSMLAIDNISMDITDHQFICLVGPSGCGKSTLLRMISGLEPI
SKGEVIIDGKPVQGTSPKVGFVFQEYTLFPWRTVQKNVEFGLEIKNVPPAEREKIAEKYI
DMVGLSGFRDSYPHQLSGGMKQRCAIARTLAVGPEILLMDEPFGALDAQTRNILQEQLLE
IWQKEKIKVIFVTHSVDEAVFLADKVVIMTARPGQIKEIVDIKLPRPRKRTDAEVNQVRD
AILKSLFTEVKKLSDR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory