Protein WP_009780429.1 in Leeuwenhoekiella blandensis MED217
Annotation: NCBI__GCF_000152985.1:WP_009780429.1
Length: 228 amino acids
Source: GCF_000152985.1 in NCBI
Candidate for 17 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-glutamate catabolism | gltL | med | GluA aka CGL1950, component of Glutamate porter (characterized) | 41% | 84% | 138.7 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 37% | 66% | 151 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-lysine catabolism | hisP | lo | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 39% | 83% | 144.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 40% | 89% | 140.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 40% | 89% | 140.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-arabinose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 34% | 61% | 137.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| D-fructose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 34% | 61% | 137.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| sucrose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 34% | 61% | 137.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| D-xylose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 34% | 61% | 137.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| D-cellobiose catabolism | cbtD | lo | CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) | 35% | 67% | 127.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-isoleucine catabolism | livG | lo | ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) | 31% | 90% | 118.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-leucine catabolism | livG | lo | ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) | 31% | 90% | 118.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| L-valine catabolism | livG | lo | ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) | 31% | 90% | 118.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| D-cellobiose catabolism | TM0027 | lo | TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) | 32% | 87% | 117.9 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| D-mannose catabolism | TM1749 | lo | TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 33% | 73% | 117.9 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| glycerol catabolism | glpS | lo | ABC transporter for Glycerol, ATPase component 1 (characterized) | 31% | 52% | 102.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
| D-cellobiose catabolism | cbtF | lo | CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) | 32% | 68% | 100.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 45% | 204.1 |
Sequence Analysis Tools
View WP_009780429.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MASILEISNLAKSYTSGSKTLKVLDDINFSITEKETFSIVGPSGSGKTTLLGLCAGLDKP
DSGTVTLNGVELSSLTEDERALLRNKDVGFVFQDFQLLPTLTALENVAVPLELQGAKHAM
KKAAELLTKVGLGDRGNHYASQLSGGEQQRVALARAFANDPKILFADEPTGNLDAETGET
VVDLLFELNKELGTTLVLVTHDMELAQKTQNILTIKGGRIADLTKASL
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory