GapMind for catabolism of small carbon sources

 

Protein WP_009780612.1 in Leeuwenhoekiella blandensis MED217

Annotation: NCBI__GCF_000152985.1:WP_009780612.1

Length: 220 amino acids

Source: GCF_000152985.1 in NCBI

Candidate for 37 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 42% 90% 149.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-asparagine catabolism aatP lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 39% 89% 143.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-aspartate catabolism aatP lo ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 39% 89% 143.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 34% 57% 133.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 56% 125.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 32% 90% 106.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 32% 90% 106.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 88% 105.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-leucine catabolism livG lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 88% 105.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-phenylalanine catabolism livG lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 88% 105.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-proline catabolism HSERO_RS00895 lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 88% 105.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-serine catabolism Ac3H11_1693 lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 88% 105.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-tyrosine catabolism Ac3H11_1693 lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 88% 105.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 33% 88% 100.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-leucine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 33% 88% 100.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-phenylalanine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 33% 88% 100.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-proline catabolism HSERO_RS00900 lo ABC transporter ATP-binding protein (characterized, see rationale) 33% 88% 100.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-serine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 33% 88% 100.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1
L-tyrosine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 33% 88% 100.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 44% 194.1

Sequence Analysis Tools

View WP_009780612.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIKAENIYKSYGDVQVLKGVDLEIKDGEVVSVVGASGAGKTTLLQILGTLDYADKNKATN
LFINDTQIADLNEKELSKFRNLNIGFIFQFHQLLPEFTALENVCIPAYIAKKSKEEAEAK
AKELLDFLGLGHRINHKPGALSGGEQQRVAVARSLINEPALILADEPSGNLDSESAENLH
QLFFKLRDTYNQTFVIVTHNEDLATMADRKLTMIDGKIIS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory